Sequence:
download
CE12272sequence.fasta
>EGL-30, isoform a MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEEDKRAHIRLVYQNVFMA IQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDL RRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKII YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
view sequence (355 aa)
>EGL-30, isoform a
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEEDKRAHIRLVYQNVFMA
IQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDL
RRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKII
YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Estimated Isoelectric Point:
5.10254669189453
Estimated Molecular Weight:
41.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys20
Gln16
Leu33
Gly11
Met9
Ser20
Tyr17
His6
Glu37
Arg27
Cys6
Phe18
Pro11
Val21
Asn13
Ala19
Ile28
Trp3
Asp24