Sequence:
download
CE12128sequence.fasta
>PQN-51 MAHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAPPPAPRQQHHVPPSAVRPNPM PPQRPVAQQPVRALSALHAAHIGDAPIRMAYTGQPTQHPSQVRMFNPQFQGGIHFQPGQVFVVQQPNGQNIPMSIMPNQI PQHRIIHQGQPQQAQQQQPQQGNQLTHMNQMDGNVGSESDGEGPSGPVKLAPKKTKCSLRVRGSGASEKKAMKVLGSLLK DFQLDGGGGGMSDSSSEDEPDDDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQSDDEDLTMLFEADNVVMCQFEKV NRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
view sequence (354 aa)
>PQN-51
MAHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAPPPAPRQQHHVPPSAVRPNPM
PPQRPVAQQPVRALSALHAAHIGDAPIRMAYTGQPTQHPSQVRMFNPQFQGGIHFQPGQVFVVQQPNGQNIPMSIMPNQI
PQHRIIHQGQPQQAQQQQPQQGNQLTHMNQMDGNVGSESDGEGPSGPVKLAPKKTKCSLRVRGSGASEKKAMKVLGSLLK
DFQLDGGGGGMSDSSSEDEPDDDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQSDDEDLTMLFEADNVVMCQFEKV
NRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Estimated Isoelectric Point:
4.99103546142578
Estimated Molecular Weight:
39.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys19
Gln36
Leu19
Gly29
Met16
Ser22
Tyr3
His11
Glu22
Arg15
Cys5
Phe10
Pro29
Val23
Asn17
Ala24
Ile14
Trp3
Asp30