Sequence:
download
CE12098sequence.fasta
>LIN-31 MPRPGKDSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADR PGKGSYWAVHPNASGMFENGSCLRRRKRFRARGGQDDDDDDFHHPAPSKISRKNPLPLLPEPPITPPLLSSLFPNLPPSL PNFCLFPPGMDPTKSLLLNPLSLLLMPHFLKNSSNFESSTPHSETSEISGSGSSSSKTPTPEAGFNSSFSIESILSS
view sequence (237 aa)
>LIN-31
MPRPGKDSYDEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKIPRRADR
PGKGSYWAVHPNASGMFENGSCLRRRKRFRARGGQDDDDDDFHHPAPSKISRKNPLPLLPEPPITPPLLSSLFPNLPPSL
PNFCLFPPGMDPTKSLLLNPLSLLLMPHFLKNSSNFESSTPHSETSEISGSGSSSSKTPTPEAGFNSSFSIESILSS
Estimated Isoelectric Point:
8.92607879638672
Estimated Molecular Weight:
26.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys13
Gln5
Leu24
Gly11
Met7
Ser33
Tyr8
His6
Glu9
Arg15
Cys3
Phe14
Pro30
Val1
Asn13
Ala7
Ile11
Trp3
Asp15