Sequence:
download
CE11382sequence.fasta
>NHX-6, isoform b MSLIRRLSVVLIGLLLILGYAQAECDEKEEEVFPSRYPIAYFKWEEVKIPMTICLWLIAASISKIVFNSIPHLNDLFPDS ALLIMIGLIIGIIFKLIGVDKNQFFLESEIFMLYLLPPLVFDAGYFMPARQFFDNFGSIMCFAMIGTLFNFLAISFSLWA ISLTGLFSVETPLLHMLLFGSVAADVDPVAVIVIFEELAVNDVLFIAVFGESLFNDGVSVVLYRMFLTFSEIGAENLIPE DFANGGVSFLVVVFGGVGIGVLFAFLASLLTKYSRAEEISILNCVFILILPYTCYLCGELFGLSSIIAVVFCGALMRQYC RENVEQETVKATEKFIKVLSIASETVIFVFLGLSTVSSNHHWDTCFIVLTVVFCLIYRTLGVVVMCHFLNKYRLNKYTKV DQFIMAYGGLRGAIAYGLVVAIPDFIPAKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYTELID TTMAGMEDIAGFKGHHWIRDSWNYFNNCYLRPVLVNKNNMKQMDKTKLVRKYKHLVDEDAKKIANGGDLKSNLAFTRALI EHTRSRTNTAITSDSNGKIDFVTHMKEHHGITVYDHENNVEYTSDYMENESEDGEYKNGGFESDGSSDNFEERV
view sequence (634 aa)
>NHX-6, isoform b
MSLIRRLSVVLIGLLLILGYAQAECDEKEEEVFPSRYPIAYFKWEEVKIPMTICLWLIAASISKIVFNSIPHLNDLFPDS
ALLIMIGLIIGIIFKLIGVDKNQFFLESEIFMLYLLPPLVFDAGYFMPARQFFDNFGSIMCFAMIGTLFNFLAISFSLWA
ISLTGLFSVETPLLHMLLFGSVAADVDPVAVIVIFEELAVNDVLFIAVFGESLFNDGVSVVLYRMFLTFSEIGAENLIPE
DFANGGVSFLVVVFGGVGIGVLFAFLASLLTKYSRAEEISILNCVFILILPYTCYLCGELFGLSSIIAVVFCGALMRQYC
RENVEQETVKATEKFIKVLSIASETVIFVFLGLSTVSSNHHWDTCFIVLTVVFCLIYRTLGVVVMCHFLNKYRLNKYTKV
DQFIMAYGGLRGAIAYGLVVAIPDFIPAKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYTELID
TTMAGMEDIAGFKGHHWIRDSWNYFNNCYLRPVLVNKNNMKQMDKTKLVRKYKHLVDEDAKKIANGGDLKSNLAFTRALI
EHTRSRTNTAITSDSNGKIDFVTHMKEHHGITVYDHENNVEYTSDYMENESEDGEYKNGGFESDGSSDNFEERV
Estimated Isoelectric Point:
5.24567413330078
Estimated Molecular Weight:
71.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys31
Gln9
Leu68
Gly40
Met20
Ser40
Tyr24
His15
Glu41
Arg18
Cys13
Phe51
Pro16
Val56
Asn32
Ala38
Ile58
Trp6
Asp28