Sequence:
download
CE10706sequence.fasta
>LIN-42, isoform c MEPAGHSSATHNIVVPNANPTQPQPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYAD GFHEQYLTIGDNFLARLEPKGQSFILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHV SSNFHVFTFITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAH NGSILRCQTEWSAYVNPWTRKMELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKVSSAISSV TFLSSGDGASHRLSSSSVLLVLTLHFYLCASLRRDTRLARRIRRRESGQQRHLSEQKVHMLALRSMAPCQEKECKNDALA GGAVSGTTDELIPRRTFLEFAWNGECNFIGGPVLYGSRRDMVQVLQKPTKLKS
view sequence (453 aa)
>LIN-42, isoform c
MEPAGHSSATHNIVVPNANPTQPQPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYAD
GFHEQYLTIGDNFLARLEPKGQSFILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHV
SSNFHVFTFITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAH
NGSILRCQTEWSAYVNPWTRKMELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKVSSAISSV
TFLSSGDGASHRLSSSSVLLVLTLHFYLCASLRRDTRLARRIRRRESGQQRHLSEQKVHMLALRSMAPCQEKECKNDALA
GGAVSGTTDELIPRRTFLEFAWNGECNFIGGPVLYGSRRDMVQVLQKPTKLKS
Estimated Isoelectric Point:
8.76842498779297
Estimated Molecular Weight:
49.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys16
Gln15
Leu50
Gly23
Met9
Ser49
Tyr8
His17
Glu20
Arg31
Cys10
Phe19
Pro25
Val29
Asn15
Ala40
Ile22
Trp4
Asp21