Sequence:
download
CE10650sequence.fasta
>F47B8.10 MSFKTHIKFVVVTIIYFAHIYFRRLPITLLPLIREEIVLTSDDIGILVSSHALLYTIGRLLFGMASDRYSKVALLLLGLV TCAACSVGLAFSNHLWQMLIAMMLLGIVQGAGWVPATLLVQSWYSKSTYGTMFSILACGSTFAGILQPFSKKFYWRNVEL YTGAGMLVFSIVCFIVLREDNVSPKQTEDDEEPNPEKKKKGGLRTIVGSIVIWHISFVYLFTMEMRTICETWVQLFLTDS KISPDAFQITYEIGGLVGTMASGIVIDLATRKFDVDATRRVIAVSYTCLMMFSAAGIFEFAELSSIFGFLAGMFVNGSIN VWCMIASQAGFSKIQGTVSAFISFIASSGSMLAGTPLAYLISVFGWKVFLYIFSVQLVIVLFVSSFRVRLRMDTTENEAS KNEIDDDESSGVCSTVVDSQRNLTSLNKKTRISMLLALYATKKIKPFRDVLASNKV
view sequence (456 aa)
>F47B8.10
MSFKTHIKFVVVTIIYFAHIYFRRLPITLLPLIREEIVLTSDDIGILVSSHALLYTIGRLLFGMASDRYSKVALLLLGLV
TCAACSVGLAFSNHLWQMLIAMMLLGIVQGAGWVPATLLVQSWYSKSTYGTMFSILACGSTFAGILQPFSKKFYWRNVEL
YTGAGMLVFSIVCFIVLREDNVSPKQTEDDEEPNPEKKKKGGLRTIVGSIVIWHISFVYLFTMEMRTICETWVQLFLTDS
KISPDAFQITYEIGGLVGTMASGIVIDLATRKFDVDATRRVIAVSYTCLMMFSAAGIFEFAELSSIFGFLAGMFVNGSIN
VWCMIASQAGFSKIQGTVSAFISFIASSGSMLAGTPLAYLISVFGWKVFLYIFSVQLVIVLFVSSFRVRLRMDTTENEAS
KNEIDDDESSGVCSTVVDSQRNLTSLNKKTRISMLLALYATKKIKPFRDVLASNKV
Estimated Isoelectric Point:
8.77558135986328
Estimated Molecular Weight:
50.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys22
Gln11
Leu49
Gly30
Met17
Ser45
Tyr14
His5
Glu17
Arg18
Cys8
Phe32
Pro10
Val40
Asn11
Ala32
Ile40
Trp8
Asp17