Sequence:
download
CE09711sequence.fasta
>RAB-5 MAARNAGTARPGGPNRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQER YHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFME TSAKTSMNVNDIFMAIAKKLPIGPAQGEPTGTVDMNQPQQQQKGSCCK
view sequence (208 aa)
>RAB-5
MAARNAGTARPGGPNRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQER
YHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFME
TSAKTSMNVNDIFMAIAKKLPIGPAQGEPTGTVDMNQPQQQQKGSCCK
Estimated Isoelectric Point:
7.62158966064453
Estimated Molecular Weight:
22.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys14
Gln16
Leu13
Gly14
Met7
Ser10
Tyr7
His2
Glu13
Arg8
Cys4
Phe8
Pro8
Val13
Asn12
Ala27
Ile9
Trp2
Asp8