Sequence:
download
CE09704sequence.fasta
>TAM-1 MDIPGTSGTSNYQQWAHVVECPICYNIYDKPMQMGCGHTLCSTCIGRLVDQVKTNMAEELGRPRGPLLHPDDIGPGFGGL GGFADQEDQPHFIDLPRLDPRMNPNDPNMVRGIVVLPRRGPEARATEIKCPECRKPTLVPADGLPVNYRVQEIVQKVAPL FKDRHLVKLCNQCEAVLSQGVYFDCSQCEETGRKICSTCAIRLHNGHQLVEKKALTSDDVREMKQKISDASHAAFQSLEN LKPRLQSVGGTIEAKALDKLTSLIKIFEFMLSTFDSKIKENSTMDELMEEVKKAEKISKVYSEAGGRVDVMLTAIESAFN SYWDPFEKLKQEMGFQIDEPTGSVNQIPASEGGAERVNEVAAPAAGRPIPQNARNLRGALNHFAQVARNRNRQARGVQQQ QDLPFLPPPPPHQLVMPPPAMPPPQHMQAQRLWGGPQPQRMNQPMMAQVGGRPGQYIMGHPPPMHHQMQQGPPRMMYMHQ QHHPMHQVEDQMQRQHQRMQQPNMNNIMHGNMQIAFQQHMHNNANVPMPPQMPAHPQQQQQQRHPNEGQQFQQGPPPPPP QRIQNHQQQMQQYHQQLQVQQQQQPQPRAQPFRPPIQQQQQLQQIDLQAMNDRQFQQLADEIVAEDQMVQNAVDPAAPAD IPRADWEEIQVAQRGAGDFGINFHPEPIVEEVEEEQPEVDQQVVVNGQVVENYRAGDINNVIHFEEVPVVLEPDVDGNVD HNNGILENNVEEQEQFDDVPPQINNFVEFDDMREQVDAIEDEEFEPVLHRAAIEFQEAADQDALEQDVRERNLLDHEAEN EEEDDGDLPYEEEDDEEEEVHVRNSVVRRRVQRPRDAAHISEVETRRSARRLARNSNNPTDEPSTSSGAAGPSNRPPHSP TPPPGNKRRRVDRKPKTEEPEQMETEPVDPVHRAPKRRGTSAASSSSNGMPSSSAPTTRSQTRL
view sequence (944 aa)
>TAM-1
MDIPGTSGTSNYQQWAHVVECPICYNIYDKPMQMGCGHTLCSTCIGRLVDQVKTNMAEELGRPRGPLLHPDDIGPGFGGL
GGFADQEDQPHFIDLPRLDPRMNPNDPNMVRGIVVLPRRGPEARATEIKCPECRKPTLVPADGLPVNYRVQEIVQKVAPL
FKDRHLVKLCNQCEAVLSQGVYFDCSQCEETGRKICSTCAIRLHNGHQLVEKKALTSDDVREMKQKISDASHAAFQSLEN
LKPRLQSVGGTIEAKALDKLTSLIKIFEFMLSTFDSKIKENSTMDELMEEVKKAEKISKVYSEAGGRVDVMLTAIESAFN
SYWDPFEKLKQEMGFQIDEPTGSVNQIPASEGGAERVNEVAAPAAGRPIPQNARNLRGALNHFAQVARNRNRQARGVQQQ
QDLPFLPPPPPHQLVMPPPAMPPPQHMQAQRLWGGPQPQRMNQPMMAQVGGRPGQYIMGHPPPMHHQMQQGPPRMMYMHQ
QHHPMHQVEDQMQRQHQRMQQPNMNNIMHGNMQIAFQQHMHNNANVPMPPQMPAHPQQQQQQRHPNEGQQFQQGPPPPPP
QRIQNHQQQMQQYHQQLQVQQQQQPQPRAQPFRPPIQQQQQLQQIDLQAMNDRQFQQLADEIVAEDQMVQNAVDPAAPAD
IPRADWEEIQVAQRGAGDFGINFHPEPIVEEVEEEQPEVDQQVVVNGQVVENYRAGDINNVIHFEEVPVVLEPDVDGNVD
HNNGILENNVEEQEQFDDVPPQINNFVEFDDMREQVDAIEDEEFEPVLHRAAIEFQEAADQDALEQDVRERNLLDHEAEN
EEEDDGDLPYEEEDDEEEEVHVRNSVVRRRVQRPRDAAHISEVETRRSARRLARNSNNPTDEPSTSSGAAGPSNRPPHSP
TPPPGNKRRRVDRKPKTEEPEQMETEPVDPVHRAPKRRGTSAASSSSNGMPSSSAPTTRSQTRL
Estimated Isoelectric Point:
5.24428558349609
Estimated Molecular Weight:
106.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys28
Gln106
Leu47
Gly53
Met39
Ser39
Tyr12
His35
Glu80
Arg64
Cys13
Phe26
Pro95
Val65
Asn52
Ala65
Ile39
Trp4
Asp56