Sequence:
download
CE09639sequence.fasta
>ACR-16 MSVCTLLISCAILAAPTLGSLQERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWN DYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQK CFFKFGSWTYDGYKLDLQPATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPC ILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRT PETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFSTKPNRHSESLIRNIKDNEHSLSRANSFDADCRLNQYIMT QSVSNGLTSLGSIPSTMISSNGTTTDVSQQATLLILHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTI FIIVSTIGIFWSAPYLVA
view sequence (498 aa)
>ACR-16
MSVCTLLISCAILAAPTLGSLQERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWN
DYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQK
CFFKFGSWTYDGYKLDLQPATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPC
ILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRT
PETHDMGPWTRNLLLYWIPWILRMKRPGHNLTYASLPSLFSTKPNRHSESLIRNIKDNEHSLSRANSFDADCRLNQYIMT
QSVSNGLTSLGSIPSTMISSNGTTTDVSQQATLLILHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTI
FIIVSTIGIFWSAPYLVA
Estimated Isoelectric Point:
5.85514068603516
Estimated Molecular Weight:
57.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys19
Gln14
Leu54
Gly21
Met14
Ser35
Tyr25
His12
Glu22
Arg20
Cys13
Phe24
Pro27
Val34
Asn27
Ala22
Ile37
Trp13
Asp25