Sequence:
download
CE09631sequence.fasta
>BLMP-1, isoform a MGQGSGDDGVPPAPFSSAAAAAHSPPHSPLSVGVSSASSATSSSSTPPSSTSPAGVSASGARNVETDWKQSGDENLAELC IFHVPDKSVSLPNPKRAECTLPMNLILKSSSKNRKKSSIWSSDHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGP AQEDVPFDEAPEEWKIYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTELSFWF SRDYARKLNYSTRPYVRVRRPATQLIPSAPPASASTAIASLAETIVAIDYSVKKLIESPIDTLSTDASSASDEEMIDVEE QESCTRPVAEVTRPNVIQNPVVRPVATKVNNFPGIPVRLGNFYASPLVDFKEFMRKSLQLKLVDTSMFVSPVAQTTAAIT ATGGRSGQPIDVQPVLAATAGAHFGNYAAIYGSQDFQHELSKPLYTSASPAFGGGGGMGGGFGMGGSAHTSSFHQLPFVN HSSSSHNDSSFNGVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTG ERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWK TTTCKEEDMKDSMRDDLMDIKGEIDEGSMSGSGYGNLGIFENTLNSELKRPLMPIETIYSKYNLPNASLLGQGPSGMQEQ QAPPPTSQQQQHMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHSGMQNGGGIPHQHQLIQGGPSSGSGQQQHPQHNGIHRL PDLKNPLLPSLGLPHYP
view sequence (817 aa)
>BLMP-1, isoform a
MGQGSGDDGVPPAPFSSAAAAAHSPPHSPLSVGVSSASSATSSSSTPPSSTSPAGVSASGARNVETDWKQSGDENLAELC
IFHVPDKSVSLPNPKRAECTLPMNLILKSSSKNRKKSSIWSSDHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGP
AQEDVPFDEAPEEWKIYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTELSFWF
SRDYARKLNYSTRPYVRVRRPATQLIPSAPPASASTAIASLAETIVAIDYSVKKLIESPIDTLSTDASSASDEEMIDVEE
QESCTRPVAEVTRPNVIQNPVVRPVATKVNNFPGIPVRLGNFYASPLVDFKEFMRKSLQLKLVDTSMFVSPVAQTTAAIT
ATGGRSGQPIDVQPVLAATAGAHFGNYAAIYGSQDFQHELSKPLYTSASPAFGGGGGMGGGFGMGGSAHTSSFHQLPFVN
HSSSSHNDSSFNGVPNYVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTG
ERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWK
TTTCKEEDMKDSMRDDLMDIKGEIDEGSMSGSGYGNLGIFENTLNSELKRPLMPIETIYSKYNLPNASLLGQGPSGMQEQ
QAPPPTSQQQQHMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHSGMQNGGGIPHQHQLIQGGPSSGSGQQQHPQHNGIHRL
PDLKNPLLPSLGLPHYP
Estimated Isoelectric Point:
7.21089935302734
Estimated Molecular Weight:
88.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys42
Gln43
Leu55
Gly69
Met21
Ser87
Tyr23
His34
Glu39
Arg34
Cys16
Phe27
Pro65
Val44
Asn36
Ala59
Ile33
Trp6
Asp38