Sequence:
download
CE09151sequence.fasta
>FUT-2 MRNVKGLFSYMTKTKSFYISIIVIIFIIFIVNRMGPRNYNYKQIGTEINCVKHKVDEQRYLLFPMITILYKYGLGNQLFE VFSLLGSAQTLNRTAIFNADDDILQSKLDLLQKQVPQVAARIISIPIEIAESTRYLFLPACCHYQFPSLFSCERSKFLVI DGQYFQSFKYFSAIDSLIRKLLKPPIDEEIILKKMIGRKDELRFKNCVHIRRGDYVNDFDHAETSSYFTIRAIDYVHTLH PGLVYLISDDPKWVRKQIAEHLDYHDDVKIMETPINAAIRDLYFSQAHCDSVLITAPSSTFGWWIGYMSKNQSNVYYRDI QETDDMVKYKMVEEDFFPPTWKKLGMSRNGSIISK
view sequence (355 aa)
>FUT-2
MRNVKGLFSYMTKTKSFYISIIVIIFIIFIVNRMGPRNYNYKQIGTEINCVKHKVDEQRYLLFPMITILYKYGLGNQLFE
VFSLLGSAQTLNRTAIFNADDDILQSKLDLLQKQVPQVAARIISIPIEIAESTRYLFLPACCHYQFPSLFSCERSKFLVI
DGQYFQSFKYFSAIDSLIRKLLKPPIDEEIILKKMIGRKDELRFKNCVHIRRGDYVNDFDHAETSSYFTIRAIDYVHTLH
PGLVYLISDDPKWVRKQIAEHLDYHDDVKIMETPINAAIRDLYFSQAHCDSVLITAPSSTFGWWIGYMSKNQSNVYYRDI
QETDDMVKYKMVEEDFFPPTWKKLGMSRNGSIISK
Estimated Isoelectric Point:
8.67261505126953
Estimated Molecular Weight:
41.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys26
Gln15
Leu29
Gly14
Met10
Ser26
Tyr21
His9
Glu15
Arg18
Cys6
Phe22
Pro14
Val19
Asn14
Ala15
Ile39
Trp4
Asp24