Sequence:
download
CE09025sequence.fasta
>SSP-19 MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDVVITRTAGAPKEDKLVVHFAS APADATDAQAAFVAVAPAGTVTIPMSATA
view sequence (109 aa)
>SSP-19
MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDVVITRTAGAPKEDKLVVHFAS
APADATDAQAAFVAVAPAGTVTIPMSATA
Estimated Isoelectric Point:
6.70664215087891
Estimated Molecular Weight:
11.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys7
Gln1
Leu3
Gly7
Met2
Ser9
Tyr1
His2
Glu3
Arg2
Cys1
Phe5
Pro9
Val13
Asn4
Ala20
Ile5
Asp6