Sequence:
download
CE08595sequence.fasta
>SRAB-9 MSSYQDHCQEMEKLSTSFFLRITLIFQLLSSLVAFPMIIAASYALWNARVSKLFHINVIIIFQVHLFGFFIHCLNRIILH VLDLYSYFLLDYCDMPPSTIRCFVLRVQYVFGLWLIGATTVPLIIERFVATIRSASYEHAGCSLGILLAVLQLSIAAFAT YFSFMRFNFSEPVMNYCMAIKSGSVSNAEMISTISLVIQVVGRILFEYLFKLNEKLRAKQLTSSLSNRYLLEQNLKSMRT LKRFADLQSIFMIIHMLLFLYLLEFGVGFEKSTYISLVELNASYPLYAVVSIVVLLKKAHLNKVRLKKSLQNHVNADQNE YFENFNRFLN
view sequence (330 aa)
>SRAB-9
MSSYQDHCQEMEKLSTSFFLRITLIFQLLSSLVAFPMIIAASYALWNARVSKLFHINVIIIFQVHLFGFFIHCLNRIILH
VLDLYSYFLLDYCDMPPSTIRCFVLRVQYVFGLWLIGATTVPLIIERFVATIRSASYEHAGCSLGILLAVLQLSIAAFAT
YFSFMRFNFSEPVMNYCMAIKSGSVSNAEMISTISLVIQVVGRILFEYLFKLNEKLRAKQLTSSLSNRYLLEQNLKSMRT
LKRFADLQSIFMIIHMLLFLYLLEFGVGFEKSTYISLVELNASYPLYAVVSIVVLLKKAHLNKVRLKKSLQNHVNADQNE
YFENFNRFLN
Estimated Isoelectric Point:
9.21767425537109
Estimated Molecular Weight:
38.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys14
Gln12
Leu50
Gly9
Met11
Ser31
Tyr16
His9
Glu14
Arg15
Cys6
Phe28
Pro6
Val24
Asn17
Ala21
Ile28
Trp2
Asp6