Sequence:
download
CE08571sequence.fasta
>ODR-3 MGSCQSNENSEGNARNKEIEKQLNADKRAGSSIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSA MCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDN CQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDE TTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKT IYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM
view sequence (356 aa)
>ODR-3
MGSCQSNENSEGNARNKEIEKQLNADKRAGSSIVKLLLLGAGECGKSTVLKQMQILHSNGFTEEEVNEKRAIVYNNTVSA
MCTILRAMDGVLHLPLENGQKEAEKAIVMKVQENGEEGEALTEEVSKAIQSLWADPGVKKAFEMRSEYQLPDSAKYFLDN
CQRISEPGYRPNDQDILYSRVATTGVVEVKFKIKELDFRVFDVGGQRSERRKWIHCFDNVESIIFITAISEYDQVLFEDE
TTNRMIESMQLFNSICNSTWFLSTAMILFMNKKDLFMEKIQRVNITTAFPDYEGGQNYEEAVSFIKQKFAELNLNPDKKT
IYMHETCATDTNQVQLVISSVIDTIIQKNLQKAGMM
Estimated Isoelectric Point:
5.12155914306641
Estimated Molecular Weight:
40.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys27
Gln20
Leu26
Gly19
Met14
Ser24
Tyr9
His4
Glu35
Arg14
Cys7
Phe16
Pro7
Val23
Asn24
Ala22
Ile26
Trp3
Asp17