Sequence:
download
CE08323sequence.fasta
>SPTL-1, isoform a MGFLPDSWHFYIETLLVALLAYVVMRNRSKRQQEKLSKKLTERQKDELIADWTPEPLVPETPQDHPVLNPKYADGKMTKD VSIDGEKYLNMASTNFLSFIGVKRIEDRAKQTIFKYGVGSCGPRGFYGTVDVHLDLEKELAKFMGCEEAVLYSYGFATVS SAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYA DLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMVMASLENALASTGGFCVGRSYVVGHQRLSG LGYCFSASLPPLLATAASEAISIIDEEPSRVQKVTEMAINGQKKLQDALSGSKFSLQGCPESPMKHIYYNGEDEEKQLDT FVETVFTKNHLLLTRARYLDKDELFKIRPSIRVMFQHDLTEEEIQRAVDAIRVVAHKF
view sequence (458 aa)
>SPTL-1, isoform a
MGFLPDSWHFYIETLLVALLAYVVMRNRSKRQQEKLSKKLTERQKDELIADWTPEPLVPETPQDHPVLNPKYADGKMTKD
VSIDGEKYLNMASTNFLSFIGVKRIEDRAKQTIFKYGVGSCGPRGFYGTVDVHLDLEKELAKFMGCEEAVLYSYGFATVS
SAIPAYAKKGDVIFVDEGVNFAIQKGLQASRSRVEYFKHNDMEHLERLLLEQEQRDKKDPKKAKSVRRFIVVEGLYVNYA
DLCPLPKIIEFKWRFKVRVFIDESWSFGVIGKTGRGVTEHFNVPMEDVDMVMASLENALASTGGFCVGRSYVVGHQRLSG
LGYCFSASLPPLLATAASEAISIIDEEPSRVQKVTEMAINGQKKLQDALSGSKFSLQGCPESPMKHIYYNGEDEEKQLDT
FVETVFTKNHLLLTRARYLDKDELFKIRPSIRVMFQHDLTEEEIQRAVDAIRVVAHKF
Estimated Isoelectric Point:
6.62589263916016
Estimated Molecular Weight:
52.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys37
Gln17
Leu41
Gly29
Met12
Ser29
Tyr17
His11
Glu37
Arg25
Cys6
Phe25
Pro19
Val38
Asn12
Ala30
Ile23
Trp4
Asp27