Sequence:
download
CE08260sequence.fasta
>MEC-8 MDGPKPNLASAASMESLNSVSSEATNPSQVRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTF LSQQDAQDARKMLQGVRFDPECAQVLRLELAKSNTKVARPKQSPPPPQHAALSAAAAGVPQFLAPMQHDLLLDPQSAALF NEQQLLALSLPHLHAAQALQAAYMPASALQQYSQNQLFAAAQMHPAAAAAASLQHSQQASQASTSACSTLFVANLSAEVN EDTLRGVFKAFSGFTRLRLHNKNGSCVAFVEYSDLQKATQAMISLQGFQITANDRGGLRIEYARNKMADVNG
view sequence (312 aa)
>MEC-8
MDGPKPNLASAASMESLNSVSSEATNPSQVRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTF
LSQQDAQDARKMLQGVRFDPECAQVLRLELAKSNTKVARPKQSPPPPQHAALSAAAAGVPQFLAPMQHDLLLDPQSAALF
NEQQLLALSLPHLHAAQALQAAYMPASALQQYSQNQLFAAAQMHPAAAAAASLQHSQQASQASTSACSTLFVANLSAEVN
EDTLRGVFKAFSGFTRLRLHNKNGSCVAFVEYSDLQKATQAMISLQGFQITANDRGGLRIEYARNKMADVNG
Estimated Isoelectric Point:
9.04485321044922
Estimated Molecular Weight:
33.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys13
Gln28
Leu37
Gly16
Met10
Ser29
Tyr6
His7
Glu11
Arg14
Cys4
Phe14
Pro19
Val15
Asn14
Ala49
Ile3
Asp11