Sequence:
download
CE08098sequence.fasta
>LET-502 MEQDELRDQLVDPKSPINIESLLDTITALVNDCKIPVLMRMKSVDNFISRYERVVESLAALRMKAADFRQLKVIGRGAFG EVHLVRHTRTNTVYAMKMLNKDDMIKRADSAFFWEERDIMAHANSEWIVRLQYAFQDPRHLYMVMEYMPGGDLVNLMTSY EVSEKWTRFYTAEIVEALAALHSMGYIHRDVKPDNMLISISGHIKLADFGTCVKMNANGVVRCSTAVGTPDYISPEVLRN QGQDAEFGKEVDWWSVGVFIYEMLVGETPFYAEALVSTYTNIMNHKTSLKFPDEPLISTQAKDIIKKFLSAAPDRLGRNS VDDIRNHKFFVNDEWTFATLREASPPVIPSLKSDDDTTHFEEIETRDRDNAGDFQLPKTFNGNQLPFIGFTYSNEYSPVK NLLKGHGAGSKQNGIEQHKPQTVVEQPLTNGHASGVPEEKYEAVKMELDSKNREFELLKDSIARNEIRAKMIENEKNSLS TKISDLERELKDNKDKLRHGADSDAKVNELAVELRMSKEYNSEMESELSKFRDKCEQLKEDLRKKSGELAQEKNETQRVF QQKKDADEAFAEIKRDYELLQTRENEKSVQLKKALDERKENGAYQQSVAKATDAEWERKMQFYEKQLEHANDERKREEQK RTAAEFDQSRVARKLAGIEANYELLQNDYKSMKEARKDLERDLQDVITEKRRLEIRVEQLMDSRNTDERVLSLCQDELVE SQEEAKYKEDGLRGKIDGFKHELENEKMKTQTLEENLLVADKERGMLKMEVQELMQRHKWEITNKDQTLKHLETQLDEIK QQSKIESSEQESNDKQTIADLRKKLDLEKAHKKAVINKLEEEMAKRQPLKKGEKGVTKSALIKKEREIMALEQERDTMSK RIAALFYENDKQAEHFNIAIQDMQTTQDALRDELKECKEELANRNVNTRYEDKRSLDSREGIPSSLSNQHIQMEGWLSLR DNTKKSRKPKWTNCFVALNEYSFTIYVDEKAVSVILLIEAGAMAHVRHVTAADLRNVDDSQLPKIFHIMYDDASCNSSRH ASNSDLSMIESFREESWKRHDFQELSYHIRTFCDVCNKKLSDIIRPTPAFECKNCHFKTHKDHVAQGSLPMCRYNTGLSR ELVLMAPQTDNCNKWVSQLRRFIESSRSAAVSVSRVSSRRHAPGSSNSSTIYQ
view sequence (1173 aa)
>LET-502
MEQDELRDQLVDPKSPINIESLLDTITALVNDCKIPVLMRMKSVDNFISRYERVVESLAALRMKAADFRQLKVIGRGAFG
EVHLVRHTRTNTVYAMKMLNKDDMIKRADSAFFWEERDIMAHANSEWIVRLQYAFQDPRHLYMVMEYMPGGDLVNLMTSY
EVSEKWTRFYTAEIVEALAALHSMGYIHRDVKPDNMLISISGHIKLADFGTCVKMNANGVVRCSTAVGTPDYISPEVLRN
QGQDAEFGKEVDWWSVGVFIYEMLVGETPFYAEALVSTYTNIMNHKTSLKFPDEPLISTQAKDIIKKFLSAAPDRLGRNS
VDDIRNHKFFVNDEWTFATLREASPPVIPSLKSDDDTTHFEEIETRDRDNAGDFQLPKTFNGNQLPFIGFTYSNEYSPVK
NLLKGHGAGSKQNGIEQHKPQTVVEQPLTNGHASGVPEEKYEAVKMELDSKNREFELLKDSIARNEIRAKMIENEKNSLS
TKISDLERELKDNKDKLRHGADSDAKVNELAVELRMSKEYNSEMESELSKFRDKCEQLKEDLRKKSGELAQEKNETQRVF
QQKKDADEAFAEIKRDYELLQTRENEKSVQLKKALDERKENGAYQQSVAKATDAEWERKMQFYEKQLEHANDERKREEQK
RTAAEFDQSRVARKLAGIEANYELLQNDYKSMKEARKDLERDLQDVITEKRRLEIRVEQLMDSRNTDERVLSLCQDELVE
SQEEAKYKEDGLRGKIDGFKHELENEKMKTQTLEENLLVADKERGMLKMEVQELMQRHKWEITNKDQTLKHLETQLDEIK
QQSKIESSEQESNDKQTIADLRKKLDLEKAHKKAVINKLEEEMAKRQPLKKGEKGVTKSALIKKEREIMALEQERDTMSK
RIAALFYENDKQAEHFNIAIQDMQTTQDALRDELKECKEELANRNVNTRYEDKRSLDSREGIPSSLSNQHIQMEGWLSLR
DNTKKSRKPKWTNCFVALNEYSFTIYVDEKAVSVILLIEAGAMAHVRHVTAADLRNVDDSQLPKIFHIMYDDASCNSSRH
ASNSDLSMIESFREESWKRHDFQELSYHIRTFCDVCNKKLSDIIRPTPAFECKNCHFKTHKDHVAQGSLPMCRYNTGLSR
ELVLMAPQTDNCNKWVSQLRRFIESSRSAAVSVSRVSSRRHAPGSSNSSTIYQ
Estimated Isoelectric Point:
5.97327423095703
Estimated Molecular Weight:
135.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys105
Gln55
Leu99
Gly40
Met38
Ser85
Tyr30
His31
Glu121
Arg78
Cys14
Phe39
Pro30
Val63
Asn60
Ala81
Ile57
Trp12
Asp82