Sequence:
download
CE07569sequence.fasta
>ACE-1 MRNSLLFFIFLPSTILAVDLIHLHDGSPLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKPKQPWRIPLNATTPPN SCIQSEDTYFGDFYGSTMWNANTKLSEDCLYLNVYVPGKVDPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVIL VAMNYRVSIFGFLYMNRPEAPGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAII QSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALRENEWAPVREFGDFPWVPVVDGDFL LENAQTSLKQGNFKKTQLLAGSNRDESIYFLTYQLPDIFPVADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVL HEYEPQDLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPL NQKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQDVWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAF WKAYLPNLMAAVADVGDPYLVWKQQMDKWQNEYITDWQYHFEQYKRYQTYRQSDSETCGG
view sequence (620 aa)
>ACE-1
MRNSLLFFIFLPSTILAVDLIHLHDGSPLFGEEVLSQTGKPLTRFQGIPFAEPPVGNLRFKKPKPKQPWRIPLNATTPPN
SCIQSEDTYFGDFYGSTMWNANTKLSEDCLYLNVYVPGKVDPNKKLAVMVWVYGGGFWSGTATLDVYDGRILTVEENVIL
VAMNYRVSIFGFLYMNRPEAPGNMGMWDQLLAMKWVHKNIDLFGGDLSRITLFGESAGAASVSIHMLSPKSAPYFHRAII
QSGSATSPWAIEPRDVALARAVILYNAMKCGNMSLINPDYDRILDCFQRADADALRENEWAPVREFGDFPWVPVVDGDFL
LENAQTSLKQGNFKKTQLLAGSNRDESIYFLTYQLPDIFPVADFFTKTDFIKDRQLWIKGVKDLLPRQILKCQLTLAAVL
HEYEPQDLPVTPRDWINAMDKMLGDYHFTCSVNEMALAHTKHGGDTYYYYFTHRASQQTWPEWMGVLHGYEINFIFGEPL
NQKRFNYTDEERELSNRFMRYWANFAKTGDPNKNEDGSFTQDVWPKYNSVSMEYMNMTVESSYPSMKRIGHGPRRKECAF
WKAYLPNLMAAVADVGDPYLVWKQQMDKWQNEYITDWQYHFEQYKRYQTYRQSDSETCGG
Estimated Isoelectric Point:
5.86785125732422
Estimated Molecular Weight:
71.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys33
Gln26
Leu53
Gly40
Met22
Ser34
Tyr32
His13
Glu31
Arg29
Cys8
Phe35
Pro38
Val34
Asn33
Ala40
Ile28
Trp19
Asp40