Sequence:
download
CE07379sequence.fasta
>MTL-1 MACKCDCKNKQCKCGDKCECSGDKCCEKYCCEEASEKKCCPAGCKGDCKCANCHCAEQKQCGDKTHQHQGTAAAH
view sequence (75 aa)
>MTL-1
MACKCDCKNKQCKCGDKCECSGDKCCEKYCCEEASEKKCCPAGCKGDCKCANCHCAEQKQCGDKTHQHQGTAAAH
Estimated Isoelectric Point:
7.79494476318359
Estimated Molecular Weight:
8.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr2
Lys13
Gln5
Gly6
Met1
Ser2
Tyr1
His4
Glu6
Cys19
Pro1
Asn2
Ala8
Asp5