Sequence:
download
CE07355sequence.fasta
>RNP-3, isoform a MADINPNHTIYVNNLNEKVKKDELKRSLHMVFTQFGEIIQLMSFRKEKMRGQAHIVFKEVSSASNALRALQGFPFYGKPM RIQYAREDSDVISRAKGTFVEKRQKSTKIAKKPYEKPAKNGKSAAEPTQKEPQETDGPGLPNNILFCSNIPEGTEPEQIQ TIFSQFPGLREVRWMPNTKDFAFIEYESEDLSEPARQALDNFRITPTQQITVKFASK
view sequence (217 aa)
>RNP-3, isoform a
MADINPNHTIYVNNLNEKVKKDELKRSLHMVFTQFGEIIQLMSFRKEKMRGQAHIVFKEVSSASNALRALQGFPFYGKPM
RIQYAREDSDVISRAKGTFVEKRQKSTKIAKKPYEKPAKNGKSAAEPTQKEPQETDGPGLPNNILFCSNIPEGTEPEQIQ
TIFSQFPGLREVRWMPNTKDFAFIEYESEDLSEPARQALDNFRITPTQQITVKFASK
Estimated Isoelectric Point:
9.29906463623047
Estimated Molecular Weight:
24.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys21
Gln14
Leu11
Gly10
Met6
Ser14
Tyr5
His3
Glu19
Arg12
Cys1
Phe14
Pro15
Val9
Asn12
Ala15
Ile15
Trp1
Asp8