Sequence:
download
CE07053sequence.fasta
>CRB-1 MKYQHFLIFCTLVTNALCNRACSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTFGEETCQC SEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHC ETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELK AEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGE PVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPF CEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSN CLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFSAKSLYIHQ SSKFSLGTSSFENIAYELEFSFRTTVENTHLASSENILGEKILSIQLLSGYLVFNMTGNSLEHLLPMRVSDAQWYTVFVK GEDNKIQIEVSTENGFSLVQKSVNGQLEVFLTRFGKISGTHHFIGCMADVRVDGDLIIFADNKRAIDIRKGCTRSEQCTR AYCQNEGICIDHWESSSCKCKPPYLKPNCVYFLPKTTFGHLDQPSIVHLSTSESENHLLRNHIELSFLMHSGKPDAVLFY IGEKHAADVLTNYLVVKIAGGLITVRYRTGGRREIEFSSKNRVDDNQEHHVQIFLDKTTRQIIIDDLIECSEPIISRMSQ EFYVDDIVIGASNVVATDSEFYKGYLQDIQINQKSVVIHPTSLTIDKIGKLERTQNVIEGAVSDPMCSSSTCKHGECSET FNDFTCRCSDGSTGKLCDKVDYCKDASCMKGSRCENADNGHYCIFPITISNGSMLTYSLAPTKFMTLPSIEFSIKAHSQN GHIFTLTIDKSTLSAYLFKKRLALATNSGSGTIQKFDSVIADGNWHQIILNPHKVLIDSVKFISDNQLYPAESKSGASLF VGEQEPQEVTFACLDLFKMGEYPTLSFTKVKIPTNSETWNLTDKASVGTGCMSTDQCGLYSTCLNGATCVDIWNKRKCVC PAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNS WMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCEMGYT GRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTR CEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINI DECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCT AQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESAMSNISYLFGPIIAVVIVFAILGCLL LFFVIRGNNAMHGHYSPSSHEFTQNRMAMPTVIKLPPQERLI
view sequence (1722 aa)
>CRB-1
MKYQHFLIFCTLVTNALCNRACSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTFGEETCQC
SEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHC
ETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELK
AEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGE
PVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPF
CEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSN
CLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFSAKSLYIHQ
SSKFSLGTSSFENIAYELEFSFRTTVENTHLASSENILGEKILSIQLLSGYLVFNMTGNSLEHLLPMRVSDAQWYTVFVK
GEDNKIQIEVSTENGFSLVQKSVNGQLEVFLTRFGKISGTHHFIGCMADVRVDGDLIIFADNKRAIDIRKGCTRSEQCTR
AYCQNEGICIDHWESSSCKCKPPYLKPNCVYFLPKTTFGHLDQPSIVHLSTSESENHLLRNHIELSFLMHSGKPDAVLFY
IGEKHAADVLTNYLVVKIAGGLITVRYRTGGRREIEFSSKNRVDDNQEHHVQIFLDKTTRQIIIDDLIECSEPIISRMSQ
EFYVDDIVIGASNVVATDSEFYKGYLQDIQINQKSVVIHPTSLTIDKIGKLERTQNVIEGAVSDPMCSSSTCKHGECSET
FNDFTCRCSDGSTGKLCDKVDYCKDASCMKGSRCENADNGHYCIFPITISNGSMLTYSLAPTKFMTLPSIEFSIKAHSQN
GHIFTLTIDKSTLSAYLFKKRLALATNSGSGTIQKFDSVIADGNWHQIILNPHKVLIDSVKFISDNQLYPAESKSGASLF
VGEQEPQEVTFACLDLFKMGEYPTLSFTKVKIPTNSETWNLTDKASVGTGCMSTDQCGLYSTCLNGATCVDIWNKRKCVC
PAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNS
WMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGPACQCEMGYT
GRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTR
CEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINI
DECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCT
AQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESAMSNISYLFGPIIAVVIVFAILGCLL
LFFVIRGNNAMHGHYSPSSHEFTQNRMAMPTVIKLPPQERLI
Estimated Isoelectric Point:
5.14260101318359
Estimated Molecular Weight:
188.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr112
Lys94
Gln68
Leu96
Gly147
Met27
Ser136
Tyr42
His48
Glu110
Arg49
Cys172
Phe79
Pro59
Val89
Asn119
Ala74
Ile91
Trp9
Asp101