Sequence:
download
CE06962sequence.fasta
>CDD-1 MTTTKANLTEFEQQLVDKAIGAMENAYCKYSNFKVGAALVCDDGEIIIGANHENASYGATICAERSAIVTALTKGHRKFK YIVVATELEAPCSPCGVCRQVLIEFGDYKVILGSSTSDQIIETTTYELLPYAFTPKSLDDHEKETEERKHHNDHNNKE
view sequence (158 aa)
>CDD-1
MTTTKANLTEFEQQLVDKAIGAMENAYCKYSNFKVGAALVCDDGEIIIGANHENASYGATICAERSAIVTALTKGHRKFK
YIVVATELEAPCSPCGVCRQVLIEFGDYKVILGSSTSDQIIETTTYELLPYAFTPKSLDDHEKETEERKHHNDHNNKE
Estimated Isoelectric Point:
5.21256256103516
Estimated Molecular Weight:
17.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys12
Gln4
Leu10
Gly9
Met2
Ser8
Tyr7
His6
Glu16
Arg4
Cys6
Phe5
Pro4
Val9
Asn8
Ala15
Ile11
Asp8