Sequence:
download
CE06296sequence.fasta
>GPA-7 MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHS MLSILRAMFHLQIEYGEPDRVRDSQLVFATVHANKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPR LSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTN RMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQREIYCH HTCATDTNNVQFVLDACLDMIIAKNLKSMGLC
view sequence (352 aa)
>GPA-7
MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHS
MLSILRAMFHLQIEYGEPDRVRDSQLVFATVHANKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPR
LSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTN
RMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQREIYCH
HTCATDTNNVQFVLDACLDMIIAKNLKSMGLC
Estimated Isoelectric Point:
7.54073333740234
Estimated Molecular Weight:
41.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys23
Gln21
Leu37
Gly14
Met10
Ser26
Tyr10
His10
Glu24
Arg24
Cys12
Phe16
Pro9
Val15
Asn18
Ala14
Ile27
Trp4
Asp22