Sequence:
download
CE06147sequence.fasta
>LET-99 MSADYSSEKFKATHLFDEILWHFRSNLSLKTNRRGLATAENSFSGKEAVDFLMIEMPRIIPNNVPERDKMQKFLEFMMDM NVISEAFPKKVKQRRPFSESRIYLFMKTLDELKHPKPRSRRSASFSGARKSAKVAQPASPAATMHRPPKARLPRRLSRSN GNIDKAGIDNSSGGVENHGFDDHKDDEIPKKQRTPKILNRSLESICTEEYTEKREVSEMKEKVYDWLPFFKSRRNHTKVN QPTRRSASLDRNHCVLEQEKAEAALRSQKVTTPPIREAPKDVVFMHPQGPLPAVPSRYQNHRTSIAGSNPALLSRGRMYE SIMRRSSVVPVADSVQANNECSFWKTELLGRLEQIYDRTLPCEWASKVDGYDIQWNMIEIDHADGIVKSRCQGLQPDYPQ TVIQFMDYLVRYPFVTHKKMDTGLEYNVNRIFITLVNRLEDLNAPLQFDECSLIVNLLCKIDSFAAMLDNGPARRWSKVM ISSSASSIEEAGLMVDGFSRDLPACGIRASKYRRRALSPFDNRVNLEIQDEKSYEIREQWLIEAIQLVLLSLPTSRRRKL HKFVTFIQSIETNAVFDLADPSNGSSNNREAAIIGLWTGVCSKCRKQQGMLITAVLLANFQSLFAVPVEFIEQVKRLECE EKDRYSGPRYAKITRSRNDWQPPVPDKPQASPAVFKKPLREVACEKTKKGLFTRLLRK
view sequence (698 aa)
>LET-99
MSADYSSEKFKATHLFDEILWHFRSNLSLKTNRRGLATAENSFSGKEAVDFLMIEMPRIIPNNVPERDKMQKFLEFMMDM
NVISEAFPKKVKQRRPFSESRIYLFMKTLDELKHPKPRSRRSASFSGARKSAKVAQPASPAATMHRPPKARLPRRLSRSN
GNIDKAGIDNSSGGVENHGFDDHKDDEIPKKQRTPKILNRSLESICTEEYTEKREVSEMKEKVYDWLPFFKSRRNHTKVN
QPTRRSASLDRNHCVLEQEKAEAALRSQKVTTPPIREAPKDVVFMHPQGPLPAVPSRYQNHRTSIAGSNPALLSRGRMYE
SIMRRSSVVPVADSVQANNECSFWKTELLGRLEQIYDRTLPCEWASKVDGYDIQWNMIEIDHADGIVKSRCQGLQPDYPQ
TVIQFMDYLVRYPFVTHKKMDTGLEYNVNRIFITLVNRLEDLNAPLQFDECSLIVNLLCKIDSFAAMLDNGPARRWSKVM
ISSSASSIEEAGLMVDGFSRDLPACGIRASKYRRRALSPFDNRVNLEIQDEKSYEIREQWLIEAIQLVLLSLPTSRRRKL
HKFVTFIQSIETNAVFDLADPSNGSSNNREAAIIGLWTGVCSKCRKQQGMLITAVLLANFQSLFAVPVEFIEQVKRLECE
EKDRYSGPRYAKITRSRNDWQPPVPDKPQASPAVFKKPLREVACEKTKKGLFTRLLRK
Estimated Isoelectric Point:
9.51770782470703
Estimated Molecular Weight:
80.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys51
Gln27
Leu57
Gly26
Met20
Ser61
Tyr16
His13
Glu48
Arg61
Cys12
Phe31
Pro43
Val40
Asn33
Ala48
Ile38
Trp9
Asp37