Sequence:
download
CE06127sequence.fasta
>NPP-1, isoform a MFARRGGITGIKAEDMPKNLPNLPDLPTTSASQAPAPATQNVSSPARRNLFGAPNDANRTLFTNSPASGTTSGTSGLFGT SSTTSGGLGGIGSTQQTAKSPVATRLAAFKSGTLGAGSLSGNTPTSFATPSALPGTNAPQSSFLSPANNLNVAPAAYRPP YSTFGGSTPFGAASTGTAAGSTLFGSSTAKPATGGFFGSSSGSTLGGLGATQQQQQPVVQQQQVIQQYHPFVKAVGDPKL FGNDNDGVVAKLNQVAAGLGVGKAPYKDGNQLLSFSMEGNLFERFVGIGYNRISERTDDEGFVTLVLRHPITNLNTEERR DKILEIIKAILGGGPNVEVRYAPGTSMRTLSDGCTEICIIAKEGGFVAGAIKLAQILNDAPKMTQLESQLQVDKTRVLPK VGMSKAQRDRYLETVPDGIDERIWRQAIKENPAPNKLLPVPVRGWEALRDRQKAQVGESKLFHEAINALGNRVEEANHEH ADAVVKMEIIRNRHKTLSYRIVRVMLAQWIVSRYSRQIDTDEDVIEAKADTLLAQMNRHNQVKFYVDKFYEILESKPDKL QESMWKMFDMTIEDEHYARRVLTKFVNICSGLYESTHQQIESLEACRRALEG
view sequence (612 aa)
>NPP-1, isoform a
MFARRGGITGIKAEDMPKNLPNLPDLPTTSASQAPAPATQNVSSPARRNLFGAPNDANRTLFTNSPASGTTSGTSGLFGT
SSTTSGGLGGIGSTQQTAKSPVATRLAAFKSGTLGAGSLSGNTPTSFATPSALPGTNAPQSSFLSPANNLNVAPAAYRPP
YSTFGGSTPFGAASTGTAAGSTLFGSSTAKPATGGFFGSSSGSTLGGLGATQQQQQPVVQQQQVIQQYHPFVKAVGDPKL
FGNDNDGVVAKLNQVAAGLGVGKAPYKDGNQLLSFSMEGNLFERFVGIGYNRISERTDDEGFVTLVLRHPITNLNTEERR
DKILEIIKAILGGGPNVEVRYAPGTSMRTLSDGCTEICIIAKEGGFVAGAIKLAQILNDAPKMTQLESQLQVDKTRVLPK
VGMSKAQRDRYLETVPDGIDERIWRQAIKENPAPNKLLPVPVRGWEALRDRQKAQVGESKLFHEAINALGNRVEEANHEH
ADAVVKMEIIRNRHKTLSYRIVRVMLAQWIVSRYSRQIDTDEDVIEAKADTLLAQMNRHNQVKFYVDKFYEILESKPDKL
QESMWKMFDMTIEDEHYARRVLTKFVNICSGLYESTHQQIESLEACRRALEG
Estimated Isoelectric Point:
8.99860382080078
Estimated Molecular Weight:
66.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys31
Gln33
Leu49
Gly57
Met12
Ser47
Tyr13
His9
Glu33
Arg35
Cys4
Phe24
Pro35
Val36
Asn31
Ala58
Ile30
Trp4
Asp26