Sequence:
download
CE06083sequence.fasta
>DEG-3 MTLKIRTIIILFCVISVTTTSQSLNATLKTFDPRLLNSTADRDIAMKNVPLVRLTRHLLSPERYDVRVRPILDHKKSLKV HISISLYQIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQA TSNYWKGEKGAELSFLYPAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADTEVSMQSFIPNEEWQVKSFKIH RHEYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVS DQMPTTSEFVPLIAWFYLSIIIIISIGTFLTSVVLSVQGRRQYGRNPPQFIRYIFFVLLPQVLLLNVPPPLQTLWGELDD DPLNVRRRKKSHYLSRNVNNGSTKMASPMSTLRVPQSAGSVSEKRQSFQMIDVTSPNSPNTARSRAPSLAPSTAKATMWE GTMSALAGTNTQLRRTSNVFNKEVDEMRRKRQCSLEWEFLATVLDRFLLIVFVGAVVIVTAGLILVGRMAQYSYDHPDDR FFNV
view sequence (564 aa)
>DEG-3
MTLKIRTIIILFCVISVTTTSQSLNATLKTFDPRLLNSTADRDIAMKNVPLVRLTRHLLSPERYDVRVRPILDHKKSLKV
HISISLYQIIEVDEPSQNIKLNVWMIQKWRDEYLDWNPNEYGMINSTIIPFHHLWIPDTYLYNSVKMSRDETERYMNIQA
TSNYWKGEKGAELSFLYPAIYTITCRLNIRFFPYDRQNCTLTISSWTNSKSALDYYADTEVSMQSFIPNEEWQVKSFKIH
RHEYKYACCAEPWVILQASLVIQRKPLYYLVNLIIPTSIITLVAITGFFTPASTDDDRTEKINLGITTLLAMSILMLMVS
DQMPTTSEFVPLIAWFYLSIIIIISIGTFLTSVVLSVQGRRQYGRNPPQFIRYIFFVLLPQVLLLNVPPPLQTLWGELDD
DPLNVRRRKKSHYLSRNVNNGSTKMASPMSTLRVPQSAGSVSEKRQSFQMIDVTSPNSPNTARSRAPSLAPSTAKATMWE
GTMSALAGTNTQLRRTSNVFNKEVDEMRRKRQCSLEWEFLATVLDRFLLIVFVGAVVIVTAGLILVGRMAQYSYDHPDDR
FFNV
Estimated Isoelectric Point:
9.25046539306641
Estimated Molecular Weight:
64.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr44
Lys24
Gln22
Leu58
Gly16
Met18
Ser49
Tyr23
His9
Glu23
Arg37
Cys6
Phe23
Pro31
Val39
Asn29
Ala28
Ile47
Trp12
Asp26