Sequence:
download
CE05996sequence.fasta
>SDN-1, isoform a MILKLNFCLSTYSVLILLSLSTQAFAANQAKTKVVPSSTISTKSLKNGISEQVEGSANIPGRLADIEVNGSGYPTDDEDG DDVHGSGKPPSSATTKSDKVTSPSHAVVTAKPTTVPTTTASFKPPVQPKPKPAANDKEIKVEEDEDDDEDEDEDDEDDEE DFADENIHNDEDFFTTTTTTTYRPIVVATTSTPRSAATNPPRQQPPMVTSTISSGPFSPFHETLANGFYAAIAGGVLVAV ITAILLVLFVVFRIRKKDEGSYALDEPKQARPYASYGYTKASTKEFYA
view sequence (288 aa)
>SDN-1, isoform a
MILKLNFCLSTYSVLILLSLSTQAFAANQAKTKVVPSSTISTKSLKNGISEQVEGSANIPGRLADIEVNGSGYPTDDEDG
DDVHGSGKPPSSATTKSDKVTSPSHAVVTAKPTTVPTTTASFKPPVQPKPKPAANDKEIKVEEDEDDDEDEDEDDEDDEE
DFADENIHNDEDFFTTTTTTTYRPIVVATTSTPRSAATNPPRQQPPMVTSTISSGPFSPFHETLANGFYAAIAGGVLVAV
ITAILLVLFVVFRIRKKDEGSYALDEPKQARPYASYGYTKASTKEFYA
Estimated Isoelectric Point:
4.57585906982422
Estimated Molecular Weight:
31.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys19
Gln7
Leu15
Gly14
Met2
Ser27
Tyr9
His4
Glu20
Arg7
Cys1
Phe12
Pro23
Val21
Asn10
Ala27
Ile14
Asp24