Sequence:
download
CE05973sequence.fasta
>GPA-8 MGALCSSETYMLDKEEYKKQVEHNKSIENDLEKDRKIKILKLLILGPGESGKSTTIKQIKIIHDEGYSAEEKMVRKHGIY MNILEGIEEIHLSVGRENKSYKNPLSFDHINEVRMFTENFKKADDSEKLLGPEVINAIQKYIKDETIAMMLRDKTVYNID DSTIYFLENFSRIIQKDYLPTEEDILKSRVPTSGVIQYKIMLKNFNFRIFDVGGQRAQRRKWLHVFDDVQAVLFITSLSE YDQVLREDATVNRMKESLNLFEKICNGRYFLNTAMILFLNKIDLFKIKIKHTNITVALTSYKGPQECDSALDYIRKRFIS LNKNKKRSIYEHVTCATDTEQIQVVIDSVIDVVIQHTMQKVGIQ
view sequence (364 aa)
>GPA-8
MGALCSSETYMLDKEEYKKQVEHNKSIENDLEKDRKIKILKLLILGPGESGKSTTIKQIKIIHDEGYSAEEKMVRKHGIY
MNILEGIEEIHLSVGRENKSYKNPLSFDHINEVRMFTENFKKADDSEKLLGPEVINAIQKYIKDETIAMMLRDKTVYNID
DSTIYFLENFSRIIQKDYLPTEEDILKSRVPTSGVIQYKIMLKNFNFRIFDVGGQRAQRRKWLHVFDDVQAVLFITSLSE
YDQVLREDATVNRMKESLNLFEKICNGRYFLNTAMILFLNKIDLFKIKIKHTNITVALTSYKGPQECDSALDYIRKRFIS
LNKNKKRSIYEHVTCATDTEQIQVVIDSVIDVVIQHTMQKVGIQ
Estimated Isoelectric Point:
8.11495208740234
Estimated Molecular Weight:
42.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys38
Gln15
Leu30
Gly15
Met11
Ser22
Tyr15
His9
Glu29
Arg17
Cys4
Phe15
Pro6
Val22
Asn20
Ala12
Ile40
Trp1
Asp24