Sequence:
download
CE05477sequence.fasta
>HIS-35 MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRI APRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTAGDKE
view sequence (127 aa)
>HIS-35
MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRI
APRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKTAGDKE
Estimated Isoelectric Point:
10.6949844360352
Estimated Molecular Weight:
13.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys12
Gln5
Leu16
Gly16
Met1
Ser4
Tyr3
His2
Glu6
Arg11
Phe1
Pro5
Val9
Asn6
Ala19
Ile4
Asp3