Sequence:
download
CE05311sequence.fasta
>GOA-1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQS LVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDL ERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET TNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSANKEIY CHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY
view sequence (354 aa)
>GOA-1
MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQS
LVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDL
ERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET
TNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSANKEIY
CHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY
Estimated Isoelectric Point:
5.28252410888672
Estimated Molecular Weight:
40.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys27
Gln15
Leu29
Gly17
Met12
Ser25
Tyr12
His7
Glu30
Arg16
Cys9
Phe19
Pro5
Val21
Asn16
Ala24
Ile22
Trp3
Asp24