Sequence:
download
CE04770sequence.fasta
>DHS-28 MSLRFDGKVAIVTGAGGGLGKTYALELAKRGCKVVVNDLGGDRHGTSSSSSMADKVVQEIKSAGGQAVANYDSVEFGDKI VKTAIDNFGRIDIVINNAGILRDVSFLKMTELDWDLIFKVHVKGAYAVTKAAWPYMRDQKYGRIVVTSSNAGVHGNFGQA NYAAAKSALIGLSNSLAQEGAKYNILANTLVPTAGSRLTETVMPQNLVDALKPDYVTPLVTYMVHDSFEESGKVFEAGAG WYGTIQYYKSKGKVISHASADDIAKNWSTITNMNGAEYIGTITEQSARLVSILEEHEASSGSSSASSGASSGGAFPSNIR SSALFQEMADGVKADPTAVKTLKSIVLYIITDGKNELGKFTLDFKSASPSVYLGDVKNGEKANATVTVADSDFVDIAAGK LNAQKAFMSGKLKVKGNVMLLQKLQTVLEKAKKSKL
view sequence (436 aa)
>DHS-28
MSLRFDGKVAIVTGAGGGLGKTYALELAKRGCKVVVNDLGGDRHGTSSSSSMADKVVQEIKSAGGQAVANYDSVEFGDKI
VKTAIDNFGRIDIVINNAGILRDVSFLKMTELDWDLIFKVHVKGAYAVTKAAWPYMRDQKYGRIVVTSSNAGVHGNFGQA
NYAAAKSALIGLSNSLAQEGAKYNILANTLVPTAGSRLTETVMPQNLVDALKPDYVTPLVTYMVHDSFEESGKVFEAGAG
WYGTIQYYKSKGKVISHASADDIAKNWSTITNMNGAEYIGTITEQSARLVSILEEHEASSGSSSASSGASSGGAFPSNIR
SSALFQEMADGVKADPTAVKTLKSIVLYIITDGKNELGKFTLDFKSASPSVYLGDVKNGEKANATVTVADSDFVDIAAGK
LNAQKAFMSGKLKVKGNVMLLQKLQTVLEKAKKSKL
Estimated Isoelectric Point:
8.96186065673828
Estimated Molecular Weight:
46.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys39
Gln12
Leu33
Gly42
Met10
Ser42
Tyr15
His6
Glu18
Arg10
Cys1
Phe14
Pro8
Val38
Asn21
Ala49
Ile24
Trp4
Asp25