Sequence:
download
CE04443sequence.fasta
>HIL-3 MSDTVVASAAVQAPAKTVKSPKAAKTTKVPKAKKPVAHPPYINMVTAAINGLKERKGSSKIAILKYITKNYNVGDQIIKI NARLRDTLNKGVVSKALVQSVGTGASGRFRVTEKKAAAAKKPVAKKAATGEKKAKKPVAQKAATGEKKAKKTTATKTKKT ADKVKKVKSPKKIAKPTAKKVAKSPAKKSAPKKAAAAKPAKKAVAPKT
view sequence (208 aa)
>HIL-3
MSDTVVASAAVQAPAKTVKSPKAAKTTKVPKAKKPVAHPPYINMVTAAINGLKERKGSSKIAILKYITKNYNVGDQIIKI
NARLRDTLNKGVVSKALVQSVGTGASGRFRVTEKKAAAAKKPVAKKAATGEKKAKKPVAQKAATGEKKAKKTTATKTKKT
ADKVKKVKSPKKIAKPTAKKVAKSPAKKSAPKKAAAAKPAKKAVAPKT
Estimated Isoelectric Point:
10.8147201538086
Estimated Molecular Weight:
21.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys52
Gln4
Leu5
Gly9
Met2
Ser11
Tyr3
His1
Glu4
Arg5
Phe1
Pro14
Val19
Asn6
Ala41
Ile9
Asp4