Sequence:
download
CE04325sequence.fasta
>PHO-1 MVSAISIVAIFALEGFVTTYSDGTKDLVFVQTLWRHGDRSPTKTFKTDPFQEDAWQFGGGGWGQLSPAGMKQHLNLGKML RNRYVTNYNFLPNKYNAKQIYVRSTDVNRTIISAMSNLLGQYGQNDNSSTPGLDYPDVDGWPAGYVPIAVHTVDDDTDHL GNMESTCPFKDQVWELAKTSDEVKSFVNSADVQAVLGNLTNYCGQPVDIDNLWIITNALYIEQIYYNATLRTKNNWFTDA FYAKADAINDQVQLFQNGIFKTVPNIVNGHDVGVLTRKVRGGPILNDMVMHINLKLMCQGQTTPNCTWINNLKNYIYSAH DTTIYAFFSALLIEEYAVKPSGGYPLYSAAVLLELYIDSVDKKPYFKMVYHEQDGSGFKDVTMGIQGCPQNSSYCDLDIL RNFANTIKPDQPIDQWCLTDLNKSSSFATVSMLFIAAILAINNNFLGLF
view sequence (449 aa)
>PHO-1
MVSAISIVAIFALEGFVTTYSDGTKDLVFVQTLWRHGDRSPTKTFKTDPFQEDAWQFGGGGWGQLSPAGMKQHLNLGKML
RNRYVTNYNFLPNKYNAKQIYVRSTDVNRTIISAMSNLLGQYGQNDNSSTPGLDYPDVDGWPAGYVPIAVHTVDDDTDHL
GNMESTCPFKDQVWELAKTSDEVKSFVNSADVQAVLGNLTNYCGQPVDIDNLWIITNALYIEQIYYNATLRTKNNWFTDA
FYAKADAINDQVQLFQNGIFKTVPNIVNGHDVGVLTRKVRGGPILNDMVMHINLKLMCQGQTTPNCTWINNLKNYIYSAH
DTTIYAFFSALLIEEYAVKPSGGYPLYSAAVLLELYIDSVDKKPYFKMVYHEQDGSGFKDVTMGIQGCPQNSSYCDLDIL
RNFANTIKPDQPIDQWCLTDLNKSSSFATVSMLFIAAILAINNNFLGLF
Estimated Isoelectric Point:
5.16353607177734
Estimated Molecular Weight:
50.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys23
Gln22
Leu38
Gly31
Met11
Ser26
Tyr23
His8
Glu10
Arg10
Cys7
Phe22
Pro19
Val31
Asn36
Ala29
Ile29
Trp9
Asp34