Sequence:
download
CE04289sequence.fasta
>DYLT-2 MEDANDRNFVLRPTPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQLPRYKYVIQTMIAE QCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFHY
view sequence (123 aa)
>DYLT-2
MEDANDRNFVLRPTPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQLPRYKYVIQTMIAE
QCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFHY
Estimated Isoelectric Point:
5.12572479248047
Estimated Molecular Weight:
13.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys6
Gln7
Leu10
Gly9
Met3
Ser4
Tyr6
His1
Glu9
Arg7
Cys4
Phe4
Pro4
Val10
Asn4
Ala10
Ile9
Trp2
Asp7