Sequence:
download
CE04178sequence.fasta
>HEN-1 MNSKVIFFVCALCSSVLSSQDGAFGHGNHRPLNDADALTAIKPVCETDRHGNKYIPCPIHDINDPRNWPCIKLADLCNGK ADCPNGDDENYFQCFYHRARSEEYRRLMKMLEEIKGK
view sequence (117 aa)
>HEN-1
MNSKVIFFVCALCSSVLSSQDGAFGHGNHRPLNDADALTAIKPVCETDRHGNKYIPCPIHDINDPRNWPCIKLADLCNGK
ADCPNGDDENYFQCFYHRARSEEYRRLMKMLEEIKGK
Estimated Isoelectric Point:
6.49269866943359
Estimated Molecular Weight:
13.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr2
Lys8
Gln2
Leu8
Gly7
Met3
Ser6
Tyr4
His5
Glu6
Arg7
Cys8
Phe5
Pro7
Val4
Asn9
Ala8
Ile7
Trp1
Asp10