Sequence:
download
CE03628sequence.fasta
>CKI-1 MSSARRCLFGRPTPEQRSRTRIWLEDAVKRMRQEESQKWGFDFELETPLPSSAGFVYEVIPENCVPEFYRTKVLTVRTTC SSLDISSTTLTPLSSPSTSDKEEPSLMDPNSSFEDEEEPKKWQFREPPTPRKTPTKRQQKMTDFMAVSRKKNSLSPNKLS PVNVIFTPKSRRPTIRTRSSCSPY
view sequence (184 aa)
>CKI-1
MSSARRCLFGRPTPEQRSRTRIWLEDAVKRMRQEESQKWGFDFELETPLPSSAGFVYEVIPENCVPEFYRTKVLTVRTTC
SSLDISSTTLTPLSSPSTSDKEEPSLMDPNSSFEDEEEPKKWQFREPPTPRKTPTKRQQKMTDFMAVSRKKNSLSPNKLS
PVNVIFTPKSRRPTIRTRSSCSPY
Estimated Isoelectric Point:
9.50745391845703
Estimated Molecular Weight:
21.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys13
Gln6
Leu11
Gly3
Met5
Ser25
Tyr3
Glu16
Arg18
Cys4
Phe9
Pro20
Val9
Asn5
Ala4
Ile5
Trp3
Asp7