Sequence:
download
CE03492sequence.fasta
>M03C11.1 MGVVRRGSDVTSHVSSVSGKSAPCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKYMNKRRCIEKGVAANVIRELTLL SKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQGKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLD EQGHAHLTDLNLATQLEDDQLATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKPEE AYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFEKKPSPVFIPCKEGLNCDPMYEL EERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAFIDFSRHNVKIEPNGFVKLN
view sequence (379 aa)
>M03C11.1
MGVVRRGSDVTSHVSSVSGKSAPCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKYMNKRRCIEKGVAANVIRELTLL
SKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQGKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLD
EQGHAHLTDLNLATQLEDDQLATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKPEE
AYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFEKKPSPVFIPCKEGLNCDPMYEL
EERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAFIDFSRHNVKIEPNGFVKLN
Estimated Isoelectric Point:
8.28264617919922
Estimated Molecular Weight:
43.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys26
Gln10
Leu34
Gly20
Met10
Ser31
Tyr18
His13
Glu29
Arg25
Cys8
Phe18
Pro17
Val25
Asn14
Ala21
Ile22
Trp4
Asp19