Sequence:
download
CE03468sequence.fasta
>ATF-2 MDVDSASLSPSSRLSVVCSASAEFSSSSSDSSNFSEGSPPESRRNSVNESVIKDEHYWERRRRNNDASRRSREKRRQNDL AMEEKIMLLSAENERLKSQLGTTPIPQPSVTEPPTSLIIPQVAKNLFPAGPIASLQASSMLTVPLLQAASHIPSMLQLCQ LQPTTIQSPVYASTQQPASTSASSLFSSSSSSAFHPFRPSESAQQSFPSSSVIVKIERRSPDSSTDVNMPQPQLQPGSSV IQQIGQPAPSGTPQPVIQAVQQGPSLLSALLSQRRPSPTVPQSRTEHISGLNSPPRHTGNKSDCESVSSSASFSPSHSSE DHSNYSNKSPQYVDRRRRNNEAAKRCRANRRAVFEYRSRRVQLLEGENEDLRTQIETLKAEIAHFKSVLAQRASVVTALH P
view sequence (401 aa)
>ATF-2
MDVDSASLSPSSRLSVVCSASAEFSSSSSDSSNFSEGSPPESRRNSVNESVIKDEHYWERRRRNNDASRRSREKRRQNDL
AMEEKIMLLSAENERLKSQLGTTPIPQPSVTEPPTSLIIPQVAKNLFPAGPIASLQASSMLTVPLLQAASHIPSMLQLCQ
LQPTTIQSPVYASTQQPASTSASSLFSSSSSSAFHPFRPSESAQQSFPSSSVIVKIERRSPDSSTDVNMPQPQLQPGSSV
IQQIGQPAPSGTPQPVIQAVQQGPSLLSALLSQRRPSPTVPQSRTEHISGLNSPPRHTGNKSDCESVSSSASFSPSHSSE
DHSNYSNKSPQYVDRRRRNNEAAKRCRANRRAVFEYRSRRVQLLEGENEDLRTQIETLKAEIAHFKSVLAQRASVVTALH
P
Estimated Isoelectric Point:
9.50222015380859
Estimated Molecular Weight:
43.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys11
Gln30
Leu29
Gly10
Met6
Ser78
Tyr5
His9
Glu24
Arg33
Cys4
Phe10
Pro36
Val23
Asn17
Ala30
Ile16
Trp1
Asp12