Sequence:
download
CE03397sequence.fasta
>LET-268 MRVLPFLLPLIPVLLATTITDLPELVVVTVATENTDGLKRLLESAKAFDINIEVLGLGEKWNGGDTRIEQGGGQKIRILS DWIEKYKDASDTMIMFVDAYDVVFNADSTTILRKFFEHYSEKRLLFGAEPFCWPDQSLAPEYPIVEFGKRFLNSGLFMGY GPEMHKILKLKSVEDKDDDQLYYTMIYLDEKLRKELNMDLDSMSKIFQNLNGVIEDVELQFKEDGTPEAYNAAYNTKPLI VHGNGPSKSHLNYLGNYLGNRWNSQLGCRTCGLEVKESEEVPLIALNLFISKPIPFIEEVLQKIAEFDYPKEKIALYIYN NQPFSIKNIQDFLQKHGKSYYTKRVINGVTEIGDREARNEAIEWNKARNVEFAFLMDGDAYFSEPKVIKDLIQYSKTYDV GIIAPMIGQPGKLFTNFWGAIAANGYYARSEDYMAIVKGNRVGYWNVPFITSAVLFNKEKLEAMKDAYSYNKNLDPDMSM CKFARDNGHFLYIDNEKYYGFLIVSDEYAETVTEGKWHPEMWQIFENRELWEARYIHPGYHKIMEPEHVVDQACPDVYDF PLMSERFCEELIEEMEGFGRWSDGSNNDKRLAGGYENVPTRDIHMNQVGFERQWLYFMDTYVRPVQEKTFIGYYHQPVES NMMFVVRYKPEEQPSLRPHHDASTFSIDIALNKKGRDYEGGGVRYIRYNCTVPADEVGYAMMFPGRLTHLHEGLATTKGT RYIMVSFINP
view sequence (730 aa)
>LET-268
MRVLPFLLPLIPVLLATTITDLPELVVVTVATENTDGLKRLLESAKAFDINIEVLGLGEKWNGGDTRIEQGGGQKIRILS
DWIEKYKDASDTMIMFVDAYDVVFNADSTTILRKFFEHYSEKRLLFGAEPFCWPDQSLAPEYPIVEFGKRFLNSGLFMGY
GPEMHKILKLKSVEDKDDDQLYYTMIYLDEKLRKELNMDLDSMSKIFQNLNGVIEDVELQFKEDGTPEAYNAAYNTKPLI
VHGNGPSKSHLNYLGNYLGNRWNSQLGCRTCGLEVKESEEVPLIALNLFISKPIPFIEEVLQKIAEFDYPKEKIALYIYN
NQPFSIKNIQDFLQKHGKSYYTKRVINGVTEIGDREARNEAIEWNKARNVEFAFLMDGDAYFSEPKVIKDLIQYSKTYDV
GIIAPMIGQPGKLFTNFWGAIAANGYYARSEDYMAIVKGNRVGYWNVPFITSAVLFNKEKLEAMKDAYSYNKNLDPDMSM
CKFARDNGHFLYIDNEKYYGFLIVSDEYAETVTEGKWHPEMWQIFENRELWEARYIHPGYHKIMEPEHVVDQACPDVYDF
PLMSERFCEELIEEMEGFGRWSDGSNNDKRLAGGYENVPTRDIHMNQVGFERQWLYFMDTYVRPVQEKTFIGYYHQPVES
NMMFVVRYKPEEQPSLRPHHDASTFSIDIALNKKGRDYEGGGVRYIRYNCTVPADEVGYAMMFPGRLTHLHEGLATTKGT
RYIMVSFINP
Estimated Isoelectric Point:
5.16855621337891
Estimated Molecular Weight:
84.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys48
Gln20
Leu59
Gly51
Met25
Ser32
Tyr44
His16
Glu62
Arg32
Cys7
Phe39
Pro36
Val43
Asn41
Ala39
Ile49
Trp12
Asp45