Sequence:
download
CE03339sequence.fasta
>LIPS-1 MLNNILILAALSCTAAMADIFGPLSDHFISHLNKRPKRNDALLRQISAFGETGSFGGKVFSEEKLGNTPIVFIHGNSDSA LKFGDGPFQSGWDEILKYFMSKDYTLAELYGITYGDRNISNSYIRHFNCQNVQLHRRFLEFVLHYTKAKQINIVAHSMGV SIARKAIQGGEFVTKTESCDIGPNLSHRIGTFIALASANYGMCPCQHAFAFPACGMETGFFPGTCPEMTCSSQDVNISET CGEVPYSNYLMNLNNSGKKDASFVASLWSDDDEILGKGNMVWGRQTSLVPHSDMRKIYSDLKHNDVKLLTAEDQYNIIHM NDQKFSLHETTEY
view sequence (333 aa)
>LIPS-1
MLNNILILAALSCTAAMADIFGPLSDHFISHLNKRPKRNDALLRQISAFGETGSFGGKVFSEEKLGNTPIVFIHGNSDSA
LKFGDGPFQSGWDEILKYFMSKDYTLAELYGITYGDRNISNSYIRHFNCQNVQLHRRFLEFVLHYTKAKQINIVAHSMGV
SIARKAIQGGEFVTKTESCDIGPNLSHRIGTFIALASANYGMCPCQHAFAFPACGMETGFFPGTCPEMTCSSQDVNISET
CGEVPYSNYLMNLNNSGKKDASFVASLWSDDDEILGKGNMVWGRQTSLVPHSDMRKIYSDLKHNDVKLLTAEDQYNIIHM
NDQKFSLHETTEY
Estimated Isoelectric Point:
6.10016632080078
Estimated Molecular Weight:
37.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys18
Gln11
Leu27
Gly26
Met11
Ser29
Tyr12
His13
Glu16
Arg11
Cys9
Phe20
Pro11
Val13
Asn22
Ala22
Ile23
Trp3
Asp19