Sequence:
download
CE03215sequence.fasta
>CEH-40 MSEASKSIMDLLSEVVKITDMTMDNEAVNKLKPQIKINPFYRAVQDVLVEQKSKIDLSTKMMKDLEAQENDERLDTMLKA EGVAGPDDSLLRIQEAAGTDQYEYRQQLLKVRRELENETKAFDKHCKKWCEYVEDVLQQQGEFRPITQQSTEKFMNKMSG KFNKVCFVLKQTACEEVIQLKKRYLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGN KRIRYKKTMAKNEDERRENRKPEDRPPPGAPGAPYSLVPNAFAGMMNPYQMMLPGHQFPIGVAPFNFSMYNPEMMAQYQQ SLQNPNQTR
view sequence (329 aa)
>CEH-40
MSEASKSIMDLLSEVVKITDMTMDNEAVNKLKPQIKINPFYRAVQDVLVEQKSKIDLSTKMMKDLEAQENDERLDTMLKA
EGVAGPDDSLLRIQEAAGTDQYEYRQQLLKVRRELENETKAFDKHCKKWCEYVEDVLQQQGEFRPITQQSTEKFMNKMSG
KFNKVCFVLKQTACEEVIQLKKRYLDARRKRRNFSKTSTEILNEYFLANINHPYPSEEVKQALAMQCNISVAQVSNWFGN
KRIRYKKTMAKNEDERRENRKPEDRPPPGAPGAPYSLVPNAFAGMMNPYQMMLPGHQFPIGVAPFNFSMYNPEMMAQYQQ
SLQNPNQTR
Estimated Isoelectric Point:
8.74706268310547
Estimated Molecular Weight:
38.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys30
Gln25
Leu23
Gly11
Met18
Ser17
Tyr12
His3
Glu28
Arg19
Cys5
Phe13
Pro19
Val18
Asn22
Ala22
Ile13
Trp2
Asp16