Sequence:
download
CE03053sequence.fasta
>SPHK-1, isoform a MFIVVVTIFENYTQWYSSLLTIFSLTIKRKLKTIRSMQDSTSKCTCTEHHMGGTICCCCRSDAEENEQLTSVILSRKPPP QEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEAL NGILCREDAFRIFPTLPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFL SIGWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRPYKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTN GSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWK DIGTRVNIAKYLLAIEHETHLDLPFVKHVEVSSMKLEVISEGSHVVLDGEVVDTKTIEVASTKNHISVFSSTA
view sequence (473 aa)
>SPHK-1, isoform a
MFIVVVTIFENYTQWYSSLLTIFSLTIKRKLKTIRSMQDSTSKCTCTEHHMGGTICCCCRSDAEENEQLTSVILSRKPPP
QEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEAL
NGILCREDAFRIFPTLPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFL
SIGWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRPYKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTN
GSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWK
DIGTRVNIAKYLLAIEHETHLDLPFVKHVEVSSMKLEVISEGSHVVLDGEVVDTKTIEVASTKNHISVFSSTA
Estimated Isoelectric Point:
6.25130462646484
Estimated Molecular Weight:
52.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys31
Gln9
Leu42
Gly29
Met10
Ser49
Tyr13
His13
Glu32
Arg19
Cys10
Phe19
Pro17
Val38
Asn22
Ala23
Ile31
Trp5
Asp23