Sequence:
download
CE02628sequence.fasta
>SCC-1 MFYAQFVLAKKGPLAKVWLAAHWEKKLTKAQIFETDVPQAIEEVIRPKVKMALRTVGHLLLGIVRIYSKKTRYLLADTNE AYQKMKINFRNGFSFEVDIPENAEIEEDFSNFIDKYNITVPEFHDADYNEQLIMANVSRREDITMKETVNFNVEFNIDAD FDGFGDEGESWQLDHLYGSVEPLSLRPTPQPESLMEVERDRDVAANGTEISRIDADSVIFSEGPTRPNLIFDNQEGGNFM PEMNLKVENQTLENDGGVGPADMFSSMIHPVREHAVADVQNDDGMDFDYQPFEPENVEPSRPQSPESFALEPLDVEHMEG RKKRQRKARKLIVDAETMISNDAFREQQEDFSDTMRVVEMAPPTRKMFNLCVSGDLQHLSREPGCKMFNRELLQRYRRCL VTREFDLNYTMQELSDSSSFTPSMEAQAEPWEDLNLNEDIQEDIQAQGPAVDEFFNDVRMDDDDDRQPAQEMDFGDNFDF PQEVEHQECAPIPIQSGFAGENKENEDAEDWSDPFGSSNSSRRGQLEAYGFGNTSTYKEDDGKWAKRAKHILKKVSADIE TSGQADFSSVTATAKNRKQAAEQFYSLLTLAKSQAISVDQSEPYGEIVIRPGANFKEACPLSSPKPMGLGNTMENSTMRT PMRPV
view sequence (645 aa)
>SCC-1
MFYAQFVLAKKGPLAKVWLAAHWEKKLTKAQIFETDVPQAIEEVIRPKVKMALRTVGHLLLGIVRIYSKKTRYLLADTNE
AYQKMKINFRNGFSFEVDIPENAEIEEDFSNFIDKYNITVPEFHDADYNEQLIMANVSRREDITMKETVNFNVEFNIDAD
FDGFGDEGESWQLDHLYGSVEPLSLRPTPQPESLMEVERDRDVAANGTEISRIDADSVIFSEGPTRPNLIFDNQEGGNFM
PEMNLKVENQTLENDGGVGPADMFSSMIHPVREHAVADVQNDDGMDFDYQPFEPENVEPSRPQSPESFALEPLDVEHMEG
RKKRQRKARKLIVDAETMISNDAFREQQEDFSDTMRVVEMAPPTRKMFNLCVSGDLQHLSREPGCKMFNRELLQRYRRCL
VTREFDLNYTMQELSDSSSFTPSMEAQAEPWEDLNLNEDIQEDIQAQGPAVDEFFNDVRMDDDDDRQPAQEMDFGDNFDF
PQEVEHQECAPIPIQSGFAGENKENEDAEDWSDPFGSSNSSRRGQLEAYGFGNTSTYKEDDGKWAKRAKHILKKVSADIE
TSGQADFSSVTATAKNRKQAAEQFYSLLTLAKSQAISVDQSEPYGEIVIRPGANFKEACPLSSPKPMGLGNTMENSTMRT
PMRPV
Estimated Isoelectric Point:
4.57457733154297
Estimated Molecular Weight:
73.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys33
Gln33
Leu39
Gly33
Met25
Ser43
Tyr14
His10
Glu65
Arg36
Cys5
Phe37
Pro38
Val36
Asn36
Ala46
Ile29
Trp6
Asp54