Sequence:
download
CE02622sequence.fasta
>IFB-2, isoform a MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRFTHVGQGVVVAQQ ETTRLVPVEQDHWDSGEVQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHL VIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTTVASSR
view sequence (543 aa)
>IFB-2, isoform a
MSAVSYSMHRTTTTTSSSSHGGVSAGHAAEEFVASAEREKQEMQQLNSRLEVYISRVRQLEDRNKELVIELDTLRGSLGN
DIGQIKFKFNDSLVKVRREISEAHSGTIGVEVKVDRLRDDLNDYRHRYEEARREVEREKTTWGGAISQAQAELDTNKSRY
AAILDEEKRLYAEQDQLYLQLAAAKDELDAAIVDRRRLQAEEDDLKIELEFLGRIHSQEITELRTLLAQAPADTREFFKN
ELALAIREIKAEYDKIIQTTRVDLETIFQSKISAVESSIVSKNEAAVFRQEEIRKMNESITTLRAKLSELEARNSALERE
ANTLQIQLGEDQRAYESELHKRDNALRFMREDCQTLIAELQALLNTKQTLDTEIAIYRKLVESEEGRFTHVGQGVVVAQQ
ETTRLVPVEQDHWDSGEVQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVIDGVQAFVFRLPSHL
VIQQHGHLKIYGRNSGGINSPPDSIVMESHPSWGQGGQVETFLYNSHGIEKASHIQTTVASSR
Estimated Isoelectric Point:
5.44968414306641
Estimated Molecular Weight:
61.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys26
Gln34
Leu47
Gly28
Met6
Ser45
Tyr13
His16
Glu61
Arg45
Cys2
Phe15
Pro7
Val36
Asn19
Ala44
Ile36
Trp3
Asp29