Sequence:
download
CE02547sequence.fasta
>PMP-2 MAVFSKLQLLGQAIPPKQYAPGVVGMLAVFALIKLYKQDIRGTKHLVAKTKKDGSKGQKAHVDGVFLGKLARILKILIPG FFSKESFYLILIAVSLLCRTYADVYMIITSTKIEASIIDRNPLLFALEAFKYVLNLPAISVTNAILKFGIAELKLRFRER LSTHLYSQYLKGFTFYKMSNLDTRIQNADQLLTQDVDRFCDGIVELYSNLSKPILDVFLYLFRLGTSLGFSSPSILFSYL LFTGVGLTYLRRPIGRLTVEEQALEGEYRYVNSRLIMNSEEIAFYQGNQSEKETIMSTFASLVQHLRKIILFRFSIGFVD NIVAKYLATVVGWYAVGSSFFDKQHKPFIGMSRNQLMQEYYNSGRMMYKMAEALGRLALAGRDMTRLSGFTSRVDTLLNV LDDVNSGNYKRTMVGEKEESSALIKSELVAGSGNLRVQDNVIRFDNVPLVTPNGDVLIERLNFEVPSGTNVLVCGPNGCG KSSLFRVLGELWPLFGGTLTKPAKGKLFYVPQRPYMTLGTLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHILERE GGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREKNITLFTVSHRKSLWKYHEYSLY MDGRGSYRFEQIDDQSDQFGS
view sequence (661 aa)
>PMP-2
MAVFSKLQLLGQAIPPKQYAPGVVGMLAVFALIKLYKQDIRGTKHLVAKTKKDGSKGQKAHVDGVFLGKLARILKILIPG
FFSKESFYLILIAVSLLCRTYADVYMIITSTKIEASIIDRNPLLFALEAFKYVLNLPAISVTNAILKFGIAELKLRFRER
LSTHLYSQYLKGFTFYKMSNLDTRIQNADQLLTQDVDRFCDGIVELYSNLSKPILDVFLYLFRLGTSLGFSSPSILFSYL
LFTGVGLTYLRRPIGRLTVEEQALEGEYRYVNSRLIMNSEEIAFYQGNQSEKETIMSTFASLVQHLRKIILFRFSIGFVD
NIVAKYLATVVGWYAVGSSFFDKQHKPFIGMSRNQLMQEYYNSGRMMYKMAEALGRLALAGRDMTRLSGFTSRVDTLLNV
LDDVNSGNYKRTMVGEKEESSALIKSELVAGSGNLRVQDNVIRFDNVPLVTPNGDVLIERLNFEVPSGTNVLVCGPNGCG
KSSLFRVLGELWPLFGGTLTKPAKGKLFYVPQRPYMTLGTLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHILERE
GGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREKNITLFTVSHRKSLWKYHEYSLY
MDGRGSYRFEQIDDQSDQFGS
Estimated Isoelectric Point:
9.13948822021484
Estimated Molecular Weight:
74.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys39
Gln27
Leu83
Gly50
Met20
Ser50
Tyr31
His9
Glu33
Arg40
Cys6
Phe37
Pro21
Val46
Asn24
Ala36
Ile40
Trp5
Asp33