Sequence:
download
CE02373sequence.fasta
>FLP-3 MISPNHLILLFCVNCAFLVASDATPKRSPLGTMRFGKRAIADEMTFEEDGYYPSNVMWKRSTVDSSEPVIRDQRTPLGTM RFGKRSAEPFGTMRFGKRNPENDTPFGTMRFGKRASEDALFGTMRFGKREDGNAPFGTMKFGKREAEEPLGTMRFGKRSA DDSAPFGTMRFGKRNPLGTMRFGK
view sequence (184 aa)
>FLP-3
MISPNHLILLFCVNCAFLVASDATPKRSPLGTMRFGKRAIADEMTFEEDGYYPSNVMWKRSTVDSSEPVIRDQRTPLGTM
RFGKRSAEPFGTMRFGKRNPENDTPFGTMRFGKRASEDALFGTMRFGKREDGNAPFGTMKFGKREAEEPLGTMRFGKRSA
DDSAPFGTMRFGKRNPLGTMRFGK
Estimated Isoelectric Point:
10.1110458374023
Estimated Molecular Weight:
20.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys12
Gln1
Leu9
Gly20
Met12
Ser11
Tyr2
His1
Glu11
Arg20
Cys2
Phe17
Pro13
Val5
Asn7
Ala12
Ile4
Trp1
Asp10