Sequence:
download
CE02306sequence.fasta
>REF-1 MVLISTPPPAYAHNRKTSQEKKRRDEINAKIKELQLLIQNESDNEKMTQGDVLNRAVEVVSRMETESPGPSSNPNRKGFF DGFRSIESLTYSFIKSLGVNSDVCQDFVQRAKQFFDRERSSLLSTVSGKSKRRSESEILHSSMSYRSQSSSPSTSESGIT IDRKEVKKNREQDRRDRQGEAFDALKNFIIENKLMTSHQVEKMQRLNTLDIIIAYIQNKKHNFVSRSDQEQSLYAHAIAE GKKTAKNIAFQFFKSDRHLVVRCADLEKFFEFSLSPKPLFGFPSMPIPIPPPSFPIFPFRPFPFFPMPMAPMATSPKSQQ SPSYSLDSPPPSSDTSSSSIETPSTPNENSNSNPKASRKSKLFRPWE
view sequence (367 aa)
>REF-1
MVLISTPPPAYAHNRKTSQEKKRRDEINAKIKELQLLIQNESDNEKMTQGDVLNRAVEVVSRMETESPGPSSNPNRKGFF
DGFRSIESLTYSFIKSLGVNSDVCQDFVQRAKQFFDRERSSLLSTVSGKSKRRSESEILHSSMSYRSQSSSPSTSESGIT
IDRKEVKKNREQDRRDRQGEAFDALKNFIIENKLMTSHQVEKMQRLNTLDIIIAYIQNKKHNFVSRSDQEQSLYAHAIAE
GKKTAKNIAFQFFKSDRHLVVRCADLEKFFEFSLSPKPLFGFPSMPIPIPPPSFPIFPFRPFPFFPMPMAPMATSPKSQQ
SPSYSLDSPPPSSDTSSSSIETPSTPNENSNSNPKASRKSKLFRPWE
Estimated Isoelectric Point:
9.56139373779297
Estimated Molecular Weight:
41.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys29
Gln18
Leu21
Gly10
Met10
Ser55
Tyr6
His6
Glu25
Arg25
Cys2
Phe25
Pro31
Val14
Asn19
Ala17
Ile21
Trp1
Asp17