Sequence:
download
CE02269sequence.fasta
>CLEC-142 MNIRNLIFLSVLTHFTAAFLCTEDWELLNVKSGPVCWALLDVPNFDSKFSLASKVCESAGADVATIHNWAERSVFTDLTN RVTEPTLTCYKSSQFSIEGQFKTIDYEKPPEYLRILNEKGKIRLSKGIKRGDRISINFAFKARTNLNGVNELTGEIRIGK NSSHYSINIKCTLQNSSPTKLCELSHPNFKRRHAVQFLKEGMENHLTVKYFGRVNLDFHGNRINLWDTEFILPTEYSYVG MDEISIENFIVNRVEHSNNCQGMDEYEFDRQSISVGTLPSILLKDENIPVPRRTLNTSTYVIPEYRLDYYDFEGSNSFLY DIRLSQDPSIAGNVAIVFWNKKLKQIILKLTLTSKRIKIEAPNEHGLLVEKLRKLDINTKICRGRSLDFRFKTISKSSSM DFFTTVSGLEKEMNEAKLELLNINFDEIRFFSDNGNFYEVKMNPLEEVVMTTCNYRKIKYIDSSETIPFLDTCYRKRRIL CQKRAENAVDKTILNEPKEKSVWKEKIIEIIQTTPETKKIEKKVEKKKERKIKEEVKEVQKEKNQITDFGEF
view sequence (552 aa)
>CLEC-142
MNIRNLIFLSVLTHFTAAFLCTEDWELLNVKSGPVCWALLDVPNFDSKFSLASKVCESAGADVATIHNWAERSVFTDLTN
RVTEPTLTCYKSSQFSIEGQFKTIDYEKPPEYLRILNEKGKIRLSKGIKRGDRISINFAFKARTNLNGVNELTGEIRIGK
NSSHYSINIKCTLQNSSPTKLCELSHPNFKRRHAVQFLKEGMENHLTVKYFGRVNLDFHGNRINLWDTEFILPTEYSYVG
MDEISIENFIVNRVEHSNNCQGMDEYEFDRQSISVGTLPSILLKDENIPVPRRTLNTSTYVIPEYRLDYYDFEGSNSFLY
DIRLSQDPSIAGNVAIVFWNKKLKQIILKLTLTSKRIKIEAPNEHGLLVEKLRKLDINTKICRGRSLDFRFKTISKSSSM
DFFTTVSGLEKEMNEAKLELLNINFDEIRFFSDNGNFYEVKMNPLEEVVMTTCNYRKIKYIDSSETIPFLDTCYRKRRIL
CQKRAENAVDKTILNEPKEKSVWKEKIIEIIQTTPETKKIEKKVEKKKERKIKEEVKEVQKEKNQITDFGEF
Estimated Isoelectric Point:
8.70081329345703
Estimated Molecular Weight:
64.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys53
Gln12
Leu48
Gly22
Met8
Ser40
Tyr17
His9
Glu50
Arg31
Cys11
Phe31
Pro18
Val30
Asn40
Ala17
Ile47
Trp6
Asp26