Sequence:
download
CE02111sequence.fasta
>NHR-17 MLAYEGPLAETNYSRQKAKEMAKKFIPGELCSVCGDVASGIHYSVAACNGCKTFFRRVVLENRTYSCKNNGDCIIDKSMR CSCRHCRYKKCIIAGMDRGELSMERRRKRKKLNGLEGSEESWETEDALINLLLYKETLYQKLLLSSAMMIHTSLREALDM TQIAFNDENHTYDERMDPKYPTNFSYWRAKILTVLVEWAKSFEVFSHLIPEDQKRLFIHTAFSNLVLAEAFHTPEKYNDR IVFPDGLCGFRNVAQSVSTDGVSNKTFGLTPTVVAVINDVLVPIRRMRLTKVEYVLLQAIIFFDPDCLSLTKHGSQLIAA KRKRLLDSLQKWLHQQTKDSIEASTRFAEILLRICNVQKVAAFKRETLCTIETFELMQPHPFTMEISKSYPDFSYF
view sequence (396 aa)
>NHR-17
MLAYEGPLAETNYSRQKAKEMAKKFIPGELCSVCGDVASGIHYSVAACNGCKTFFRRVVLENRTYSCKNNGDCIIDKSMR
CSCRHCRYKKCIIAGMDRGELSMERRRKRKKLNGLEGSEESWETEDALINLLLYKETLYQKLLLSSAMMIHTSLREALDM
TQIAFNDENHTYDERMDPKYPTNFSYWRAKILTVLVEWAKSFEVFSHLIPEDQKRLFIHTAFSNLVLAEAFHTPEKYNDR
IVFPDGLCGFRNVAQSVSTDGVSNKTFGLTPTVVAVINDVLVPIRRMRLTKVEYVLLQAIIFFDPDCLSLTKHGSQLIAA
KRKRLLDSLQKWLHQQTKDSIEASTRFAEILLRICNVQKVAAFKRETLCTIETFELMQPHPFTMEISKSYPDFSYF
Estimated Isoelectric Point:
8.72516632080078
Estimated Molecular Weight:
45.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys29
Gln12
Leu40
Gly15
Met12
Ser28
Tyr14
His10
Glu28
Arg26
Cys14
Phe21
Pro13
Val22
Asn16
Ala26
Ile23
Trp4
Asp19