Sequence:
download
CE02031sequence.fasta
>KLP-6 MGKGDSIIVAVRVRPFNDREKTRNCKLVIEMPDEETTVIRDPKTNDEKRFTYDHSYWSHDGFSEKKNGYLEPTDPHYADQ RRVFEDLGRGVLANAWAGYNCSLFAYGQTGSGKSYSIVGFKNNKGIVPIVCEELFKQIADNKKKNMQFEVFVSMMEIYCE KVRDLLSSTPPPKGGLKVREHPKNGFYVENLTTVPVNSFKEIEAKIEEGTKSRTIAATQMNATSSRAHTIVKITFNQKSS KQAGGTSMKKSEINLVDLAGSERQSAAGTEGDRLKEGIVINQSLTTLGRVIKALHDSQKAKSGKKTQIPYRDSVLTCLLK NALGGNSKTIMIAAISPADINFEETLSTLRFADRAKSIKTNAVVNENQTERALRELREENLRLQSQIQGGTAGDASNEEI EKLRRQLAENQKEMEEMEKSWQQKIAEEAAKHASGASEKVEMEAKKKKMCHLWNLNEDPALTNVIVHFIPVGESVVGNKP TSSGNFIQMSGLSILPQHVTLKNDGNNQIHLSPCSEDLDIFINGKPVHGETQLQQNDRVFFGGNHLYVFNNPTKKGIRTD ITYENAQAEIAQNHAAALGNRGLGGGSKRDLILEEELMSTLPLVQRANAMATELGRNVKFEIVLVSPEMRGLTSGLTEIW VKVHNISEDTYFLWEKSRFMNRYYGMQEMYEAKQDGSEDWNMPKERDPFYEPPDSPVFIASSVVFLQSLAYLIDVEEQFP IVDLSGQEIGLLTVGLSPCSTTGKELRGEYVEDPDQLIGKNIAFKVKVISAVGLPRRILKSNCKYRFFGSKKMTTTATVS GNTPAYGHEETFQFKPVTKEVADYLANSNLYITFWGTQRPRGASSRKNSISTIGSNEAREGPNKAKRVERLVHQAKTSEN RNISVKALETVLKGVDDNENRKTRKQSMKKAGSTTIKSRSGSKKPKAK
view sequence (928 aa)
>KLP-6
MGKGDSIIVAVRVRPFNDREKTRNCKLVIEMPDEETTVIRDPKTNDEKRFTYDHSYWSHDGFSEKKNGYLEPTDPHYADQ
RRVFEDLGRGVLANAWAGYNCSLFAYGQTGSGKSYSIVGFKNNKGIVPIVCEELFKQIADNKKKNMQFEVFVSMMEIYCE
KVRDLLSSTPPPKGGLKVREHPKNGFYVENLTTVPVNSFKEIEAKIEEGTKSRTIAATQMNATSSRAHTIVKITFNQKSS
KQAGGTSMKKSEINLVDLAGSERQSAAGTEGDRLKEGIVINQSLTTLGRVIKALHDSQKAKSGKKTQIPYRDSVLTCLLK
NALGGNSKTIMIAAISPADINFEETLSTLRFADRAKSIKTNAVVNENQTERALRELREENLRLQSQIQGGTAGDASNEEI
EKLRRQLAENQKEMEEMEKSWQQKIAEEAAKHASGASEKVEMEAKKKKMCHLWNLNEDPALTNVIVHFIPVGESVVGNKP
TSSGNFIQMSGLSILPQHVTLKNDGNNQIHLSPCSEDLDIFINGKPVHGETQLQQNDRVFFGGNHLYVFNNPTKKGIRTD
ITYENAQAEIAQNHAAALGNRGLGGGSKRDLILEEELMSTLPLVQRANAMATELGRNVKFEIVLVSPEMRGLTSGLTEIW
VKVHNISEDTYFLWEKSRFMNRYYGMQEMYEAKQDGSEDWNMPKERDPFYEPPDSPVFIASSVVFLQSLAYLIDVEEQFP
IVDLSGQEIGLLTVGLSPCSTTGKELRGEYVEDPDQLIGKNIAFKVKVISAVGLPRRILKSNCKYRFFGSKKMTTTATVS
GNTPAYGHEETFQFKPVTKEVADYLANSNLYITFWGTQRPRGASSRKNSISTIGSNEAREGPNKAKRVERLVHQAKTSEN
RNISVKALETVLKGVDDNENRKTRKQSMKKAGSTTIKSRSGSKKPKAK
Estimated Isoelectric Point:
8.99742889404297
Estimated Molecular Weight:
103.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr58
Lys82
Gln38
Leu66
Gly67
Met22
Ser72
Tyr23
His17
Glu78
Arg49
Cys9
Phe33
Pro36
Val58
Asn59
Ala61
Ile54
Trp8
Asp38